Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056490
Gene name
Locationscaffold_3:928995..931076
Strand+
Gene length (bp)2081
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain 2.6E-80 323 548
PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain 1.9E-77 151 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34809|NMT_CRYNE Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans PE=1 SV=3 95 550 9.0E-169
sp|P0CP20|NMT_CRYNJ Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNN00080 PE=3 SV=1 95 550 7.0E-168
sp|P0CP21|NMT_CRYNB Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBN0070 PE=3 SV=1 95 550 7.0E-168
sp|Q4PB56|NMT_USTMA Glycylpeptide N-tetradecanoyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NMT1 PE=3 SV=1 71 532 1.0E-156
sp|Q9UVX3|NMT_ASPFU Glycylpeptide N-tetradecanoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nmt1 PE=1 SV=1 104 550 3.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34809|NMT_CRYNE Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans PE=1 SV=3 95 550 9.0E-169
sp|P0CP20|NMT_CRYNJ Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNN00080 PE=3 SV=1 95 550 7.0E-168
sp|P0CP21|NMT_CRYNB Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBN0070 PE=3 SV=1 95 550 7.0E-168
sp|Q4PB56|NMT_USTMA Glycylpeptide N-tetradecanoyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NMT1 PE=3 SV=1 71 532 1.0E-156
sp|Q9UVX3|NMT_ASPFU Glycylpeptide N-tetradecanoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nmt1 PE=1 SV=1 104 550 3.0E-152
sp|Q8TFN1|NMT_EMENI Glycylpeptide N-tetradecanoyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swoF PE=1 SV=2 102 550 1.0E-151
sp|Q4I061|NMT_GIBZE Glycylpeptide N-tetradecanoyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NMT1 PE=3 SV=1 102 549 2.0E-140
sp|O43010|NMT_SCHPO Glycylpeptide N-tetradecanoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmt1 PE=1 SV=1 99 550 2.0E-138
sp|P34763|NMT_AJECA Glycylpeptide N-tetradecanoyltransferase OS=Ajellomyces capsulatus PE=3 SV=1 102 550 4.0E-136
sp|Q9LTR9|NMT1_ARATH Glycylpeptide N-tetradecanoyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=2 129 526 4.0E-136
sp|Q7S3C8|NMT_NEUCR Glycylpeptide N-tetradecanoyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtt-1 PE=3 SV=2 23 550 2.0E-134
sp|O74234|NMT_CANGA Glycylpeptide N-tetradecanoyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NMT1 PE=3 SV=2 100 550 7.0E-134
sp|P14743|NMT_YEAST Glycylpeptide N-tetradecanoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMT1 PE=1 SV=1 124 550 2.0E-130
sp|P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens GN=NMT1 PE=1 SV=2 94 532 7.0E-130
sp|Q8K1Q0|NMT1_RAT Glycylpeptide N-tetradecanoyltransferase 1 OS=Rattus norvegicus GN=Nmt1 PE=1 SV=1 94 532 7.0E-130
sp|O70310|NMT1_MOUSE Glycylpeptide N-tetradecanoyltransferase 1 OS=Mus musculus GN=Nmt1 PE=1 SV=1 94 532 2.0E-129
sp|Q75EK2|NMT_ASHGO Glycylpeptide N-tetradecanoyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NMT1 PE=3 SV=1 116 550 2.0E-129
sp|Q6CMK4|NMT_KLULA Glycylpeptide N-tetradecanoyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMT1 PE=3 SV=1 124 550 1.0E-128
sp|Q5RAF3|NMT1_PONAB Glycylpeptide N-tetradecanoyltransferase 1 OS=Pongo abelii GN=NMT1 PE=2 SV=1 94 532 3.0E-128
sp|P30418|NMT_CANAL Glycylpeptide N-tetradecanoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NMT1 PE=1 SV=1 100 550 3.0E-128
sp|P31717|NMT1_BOVIN Glycylpeptide N-tetradecanoyltransferase 1 OS=Bos taurus GN=NMT1 PE=1 SV=2 94 532 3.0E-127
sp|A7YT82|NMT2_DANRE Glycylpeptide N-tetradecanoyltransferase 2 OS=Danio rerio GN=nmt2 PE=2 SV=2 96 536 6.0E-127
sp|O60551|NMT2_HUMAN Glycylpeptide N-tetradecanoyltransferase 2 OS=Homo sapiens GN=NMT2 PE=1 SV=1 96 527 5.0E-126
sp|Q6BJF4|NMT_DEBHA Glycylpeptide N-tetradecanoyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NMT1 PE=3 SV=1 108 550 4.0E-125
sp|Q9N181|NMT2_BOVIN Glycylpeptide N-tetradecanoyltransferase 2 OS=Bos taurus GN=NMT2 PE=2 SV=1 96 527 8.0E-125
sp|O70311|NMT2_MOUSE Glycylpeptide N-tetradecanoyltransferase 2 OS=Mus musculus GN=Nmt2 PE=1 SV=1 96 527 6.0E-124
sp|Q8ILW6|NMT_PLAF7 Glycylpeptide N-tetradecanoyltransferase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0127 PE=3 SV=1 119 528 3.0E-121
sp|Q6C7G2|NMT_YARLI Glycylpeptide N-tetradecanoyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NMT1 PE=3 SV=1 123 550 3.0E-120
sp|O61613|NMT_DROME Glycylpeptide N-tetradecanoyltransferase OS=Drosophila melanogaster GN=Nmt PE=2 SV=2 111 536 6.0E-118
sp|P46548|NMT_CAEEL Probable glycylpeptide N-tetradecanoyltransferase OS=Caenorhabditis elegans GN=nmt-1 PE=3 SV=1 95 530 9.0E-118
sp|Q553B6|NMT_DICDI Glycylpeptide N-tetradecanoyltransferase OS=Dictyostelium discoideum GN=nmt PE=3 SV=2 129 527 4.0E-117
sp|Q94L32|NMT2_ARATH Putative glycylpeptide N-tetradecanoyltransferase 2 OS=Arabidopsis thaliana GN=NMT2 PE=5 SV=1 129 526 8.0E-98
sp|Q5UR64|NMT_MIMIV Putative glycylpeptide N-tetradecanoyltransferase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L621 PE=3 SV=1 158 459 1.0E-11
sp|Q9EMI7|NMT_AMEPV Putative glycylpeptide N-tetradecanoyltransferase OS=Amsacta moorei entomopoxvirus GN=AMV219 PE=3 SV=1 180 300 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004379 glycylpeptide N-tetradecanoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016410 N-acyltransferase activity No
GO:0019107 myristoyltransferase activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056490
MTSKDKGKESIQHDATTEDHPDEEDQTDDDGHDDPSQIAGTSASGAASASKKKKKKKSKLSKLMKRDKSNIPEAF
VHQVIERVKAEGSIPEEDLTVENIRGVLEHLKIMDVVQGKAGLLGSNAKDMGEHKFWETQPVPQPGEGPPLDDGY
IEPSKPREDIRQEPYPLPKEFEWSLLDIGDPQQCKEVYDLLSANYVEDDQASFRFKYSAEFLKWALMPPGYHKEW
HIGVRVVSSKKLVAFISGVPMTLHVRKNIITVTEINYLCVHKRLRSKRLAPVLIKEVTRQTHLKGIFQAIYTAGV
IIPTPVSTCRYFHRSINVPKLLEVGFCFVPRNMTQARMIRLNAVPDTPTIPGVREMEVKDVLQTASLFTRYMRRF
GLAPIFDVEEIKHYFLSGKGEGNIGDGGPGRRKGQVTWSFVVEDPETHQITDFFSFYSLPSTVIGNQKHPILEAA
YLFYYATTVAFEPNAEEDGRLKARVKALITDAFAIAGAAKFDVFNALTLMDNANILQDLKFGPGDGFLNFYLYNW
RTAPLAGMNPEGDVPAGKGVGIVML*
Coding >AgabiH97|056490
ATGACTTCCAAAGACAAAGGGAAGGAATCCATTCAACACGATGCAACAACAGAAGATCATCCTGACGAGGAGGAT
CAAACCGATGACGATGGCCACGATGACCCTAGTCAAATTGCAGGAACTTCTGCCAGTGGCGCTGCCTCGGCAAGC
AAGAAGAAAAAGAAGAAAAAATCGAAACTCTCTAAATTGATGAAACGTGATAAATCGAATATCCCGGAGGCGTTT
GTTCATCAGGTTATAGAGCGTGTTAAGGCTGAAGGAAGTATCCCGGAGGAAGATTTGACAGTAGAGAATATCAGG
GGAGTATTAGAGCACTTGAAGATAATGGATGTTGTGCAGGGGAAAGCAGGGCTGCTTGGTTCGAACGCGAAAGAC
ATGGGAGAGCACAAGTTCTGGGAGACGCAGCCAGTACCCCAACCAGGCGAAGGTCCCCCACTCGATGATGGATAT
ATTGAGCCTTCAAAACCCCGAGAAGACATTCGCCAAGAACCTTATCCGCTCCCTAAAGAATTTGAATGGAGTTTA
TTGGACATCGGCGATCCCCAACAGTGCAAAGAAGTCTATGATCTATTATCAGCTAACTATGTCGAGGACGATCAG
GCAAGCTTCAGATTCAAGTATAGCGCCGAATTCCTAAAGTGGGCTCTTATGCCTCCAGGTTATCACAAAGAGTGG
CACATTGGTGTTCGCGTGGTCTCTTCAAAAAAACTTGTTGCATTCATATCGGGCGTACCTATGACCCTTCATGTT
CGTAAAAACATTATTACCGTAACCGAAATCAACTATCTCTGCGTACACAAACGACTGCGATCCAAACGCTTGGCA
CCCGTGCTCATCAAGGAAGTTACCCGTCAAACCCATCTGAAGGGTATTTTCCAGGCAATATACACCGCTGGTGTC
ATCATTCCGACTCCAGTATCTACGTGCAGGTATTTCCACCGCTCGATCAATGTACCCAAACTCTTGGAGGTCGGC
TTCTGCTTTGTTCCTCGTAATATGACACAGGCTCGCATGATCCGTCTTAATGCCGTTCCTGATACCCCTACTATT
CCCGGCGTACGAGAGATGGAAGTCAAGGACGTACTACAGACGGCCAGTCTCTTTACGAGATATATGAGGAGGTTC
GGGCTTGCGCCGATCTTTGATGTAGAAGAGATAAAACATTATTTTTTGAGTGGAAAGGGAGAAGGCAATATTGGC
GATGGTGGTCCTGGAAGAAGGAAAGGACAAGTGACCTGGTCATTCGTTGTCGAGGACCCCGAGACACATCAAATC
ACAGATTTCTTCTCCTTCTACTCACTCCCTTCTACCGTCATCGGCAACCAAAAGCATCCCATTCTCGAAGCGGCT
TACCTATTTTATTATGCGACAACTGTTGCCTTCGAGCCTAATGCAGAAGAGGATGGACGTCTGAAAGCTCGCGTA
AAGGCCTTGATCACCGACGCGTTCGCCATAGCTGGAGCTGCCAAATTTGATGTTTTCAATGCTCTAACTCTGATG
GACAACGCTAATATACTTCAAGATCTCAAGTTCGGACCTGGCGATGGATTTTTGAATTTTTATCTTTACAACTGG
AGGACGGCGCCGTTGGCGGGTATGAATCCAGAGGGCGATGTTCCAGCCGGTAAAGGTGTTGGCATTGTTATGCTT
TGA
Transcript >AgabiH97|056490
ATGACTTCCAAAGACAAAGGGAAGGAATCCATTCAACACGATGCAACAACAGAAGATCATCCTGACGAGGAGGAT
CAAACCGATGACGATGGCCACGATGACCCTAGTCAAATTGCAGGAACTTCTGCCAGTGGCGCTGCCTCGGCAAGC
AAGAAGAAAAAGAAGAAAAAATCGAAACTCTCTAAATTGATGAAACGTGATAAATCGAATATCCCGGAGGCGTTT
GTTCATCAGGTTATAGAGCGTGTTAAGGCTGAAGGAAGTATCCCGGAGGAAGATTTGACAGTAGAGAATATCAGG
GGAGTATTAGAGCACTTGAAGATAATGGATGTTGTGCAGGGGAAAGCAGGGCTGCTTGGTTCGAACGCGAAAGAC
ATGGGAGAGCACAAGTTCTGGGAGACGCAGCCAGTACCCCAACCAGGCGAAGGTCCCCCACTCGATGATGGATAT
ATTGAGCCTTCAAAACCCCGAGAAGACATTCGCCAAGAACCTTATCCGCTCCCTAAAGAATTTGAATGGAGTTTA
TTGGACATCGGCGATCCCCAACAGTGCAAAGAAGTCTATGATCTATTATCAGCTAACTATGTCGAGGACGATCAG
GCAAGCTTCAGATTCAAGTATAGCGCCGAATTCCTAAAGTGGGCTCTTATGCCTCCAGGTTATCACAAAGAGTGG
CACATTGGTGTTCGCGTGGTCTCTTCAAAAAAACTTGTTGCATTCATATCGGGCGTACCTATGACCCTTCATGTT
CGTAAAAACATTATTACCGTAACCGAAATCAACTATCTCTGCGTACACAAACGACTGCGATCCAAACGCTTGGCA
CCCGTGCTCATCAAGGAAGTTACCCGTCAAACCCATCTGAAGGGTATTTTCCAGGCAATATACACCGCTGGTGTC
ATCATTCCGACTCCAGTATCTACGTGCAGGTATTTCCACCGCTCGATCAATGTACCCAAACTCTTGGAGGTCGGC
TTCTGCTTTGTTCCTCGTAATATGACACAGGCTCGCATGATCCGTCTTAATGCCGTTCCTGATACCCCTACTATT
CCCGGCGTACGAGAGATGGAAGTCAAGGACGTACTACAGACGGCCAGTCTCTTTACGAGATATATGAGGAGGTTC
GGGCTTGCGCCGATCTTTGATGTAGAAGAGATAAAACATTATTTTTTGAGTGGAAAGGGAGAAGGCAATATTGGC
GATGGTGGTCCTGGAAGAAGGAAAGGACAAGTGACCTGGTCATTCGTTGTCGAGGACCCCGAGACACATCAAATC
ACAGATTTCTTCTCCTTCTACTCACTCCCTTCTACCGTCATCGGCAACCAAAAGCATCCCATTCTCGAAGCGGCT
TACCTATTTTATTATGCGACAACTGTTGCCTTCGAGCCTAATGCAGAAGAGGATGGACGTCTGAAAGCTCGCGTA
AAGGCCTTGATCACCGACGCGTTCGCCATAGCTGGAGCTGCCAAATTTGATGTTTTCAATGCTCTAACTCTGATG
GACAACGCTAATATACTTCAAGATCTCAAGTTCGGACCTGGCGATGGATTTTTGAATTTTTATCTTTACAACTGG
AGGACGGCGCCGTTGGCGGGTATGAATCCAGAGGGCGATGTTCCAGCCGGTAAAGGTGTTGGCATTGTTATGCTT
TGA
Gene >AgabiH97|056490
ATGACTTCCAAAGACAAAGGGAAGGAATCCATTCAACACGATGCAACAACAGAAGATCATCCTGACGAGGAGGAT
CAAACCGATGACGATGGCCACGATGACCCTAGTCAAATTGCAGGAACTTCTGCCAGTGGCGCTGCCTCGGCAAGC
AAGAAGAAAAAGAAGAAAAAATCGAAACTCTCTAAATTGATGAAACGTGATAAATCGAATATCCCGGAGGCGTTT
GTTCATCAGGTTATAGAGCGTGTTAAGGCTGAAGGAAGTATCCCGGAGGAAGATTTGACAGTAGAGAATATCAGG
GGAGTATTAGAGCACTTGAAGATAATGGATGTTGTGCAGGGGAAAGCAGGGCTGCTTGGTTCGAACGCGAAAGAC
ATGGGAGAGCACAAGGTATGTGTTTTCATCGTGTTTTGTCAAAGGATATCTTTTGACCTCAAAGAACTAGTTCTG
GGAGACGCAGCCAGTACCCCAACCAGGTTCGTATTAACCACTCTTACTATCAAATCTCTCATCATCTCGCGCACC
AGGCGAAGGTCCCCCACTCGATGATGGATATATTGAGCCTTCAAAACCCCGAGAAGACATTCGCCAAGAACCTTA
TCCGCTCCCTAAAGAATTTGAATGGAGTTTATTGGACATCGGCGATCCCCAACAGGTTTGTTTCCAAACCGACTT
TACGAGCACAACTTACTCATAAGCTAGCGCTTAGTGCAAAGAAGTCTATGATCTATTATCAGCTAACTATGTCGA
GGACGATCAGGCAAGCTTCAGATTCAAGTATAGCGCCGAATTCCTAAAGTGGTATGATAAAATTATACTCTAATC
TTTCCCCGCCCTAATTACTTGTAGGGCTCTTATGCCTCCAGGTTATCACAAAGAGTGGCACATTGGTGTTCGCGT
GGTCTCTTCAAAAAAACTTGTTGCATTCATATCGGGCGTACCTATGACCCTTCATGTTCGTAAAAAGTGCGTCTC
ATATTTCTTTTTATCCAGACATCCTCATCAGTGCTGCGTGAAGCATTATTACCGTAACCGAAATCAACTATCTCT
GCGTACACAAACGACTGCGATCCAAACGCTTGGCACCCGTGCTCATCAAGGAAGTTACCCGTCAAACCCATCTGA
AGGGTATTTTCCAGGCAATATACACCGCTGGTGTCATCATTCCGACTCCAGTATCTACGTGCAGGTCTGTTCTAT
ACCTGTCATCAGTACCTCCCACTCAATTTTTGGTCTTTAAAAAAGGTATTTCCACCGCTCGATCAATGTACCCAA
ACTCTTGGAGGTCGGCTTCTGCTTTGTTCCTCGTAATATGACACAGGCTCGCATGATCCGTCTTAATGCCGTTCC
TGATACCCCTACTATTCCCGGCGTACGAGAGATGGAAGTCAAGGACGTACTACAGACGGCCAGTCTCTTTACGAG
ATATATGAGGAGGTTCGGGCTTGCGCCGATCTTTGATGTAGAAGAGATAAAACATTATTTTTTGAGTGGAAAGGG
AGAAGGCAATATTGGCGATGGTGGTCCTGGAAGAAGGAAAGGACAAGTGACCTGGTCATTCGTTGTCGAGGTGAG
TTATTTTCAAGTATACCTTCACCGGGTTTCAAATCGAATTTTTTTCCCTTAGGACCCCGAGACACATCAAATCAC
AGATTTCTTCTCCTTCTACTCACTCCCTTCTACCGTCATCGGCAACCAAAAGCATCCCATTCTCGAAGCGGCTTA
CCTATTTTATTATGCGACAACTGTTGCCTTCGAGCCTAATGCAGAAGAGGATGGACGTCTGAAAGCTCGCGTAAA
GGCCTTGATCACCGACGCGTTCGCCATAGCTGGAGCTGCCAAATTTGATGTTTTCAATGCTCTAACTCTGATGGA
CAACGCTAATATACTTCAAGATCTCAAGGTGCGTTTAATATTCAGAATGCATGATATGGATGCACTGATGTTGAA
TTCTGCAGTTCGGACCTGGCGATGGATTTTTGAATTTTTATCTTTACAACTGGAGGACGGCGCCGTTGGCGGGTA
TGAATCCAGAGGGCGATGTTCCAGCCGGTAAAGGTGTTGGCATTGTTATGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail