Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056470
Gene name
Locationscaffold_3:924363..927235
Strand-
Gene length (bp)2872
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 1.1E-34 189 453
PF01483 P_proprotein Proprotein convertase P-domain 1.6E-26 538 625

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 1 640 7.0E-163
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 127 672 7.0E-161
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 3 706 2.0E-153
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 91 648 1.0E-152
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 154 742 4.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 1 640 7.0E-163
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 127 672 7.0E-161
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 3 706 2.0E-153
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 91 648 1.0E-152
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 154 742 4.0E-139
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 11 629 7.0E-116
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 11 629 2.0E-115
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 8 629 3.0E-115
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 8 629 9.0E-115
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 109 629 6.0E-114
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 8 629 1.0E-113
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 140 629 8.0E-113
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 109 629 1.0E-112
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 109 629 2.0E-112
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 129 629 1.0E-111
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 129 608 8.0E-109
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 123 629 3.0E-108
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 100 656 3.0E-108
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 100 629 2.0E-107
sp|P29119|FURI1_XENLA Furin-1 OS=Xenopus laevis GN=furin PE=2 SV=1 109 629 3.0E-107
sp|P21661|NEC2_MOUSE Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1 125 605 2.0E-106
sp|Q03333|NEC2_PIG Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1 125 628 2.0E-106
sp|P28841|NEC2_RAT Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 125 605 2.0E-106
sp|Q5REC2|NEC2_PONAB Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1 125 605 3.0E-106
sp|P16519|NEC2_HUMAN Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2 125 605 3.0E-106
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 125 628 1.0E-105
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 130 629 7.0E-105
sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 124 639 4.0E-104
sp|Q62849|PCSK7_RAT Proprotein convertase subtilisin/kexin type 7 OS=Rattus norvegicus GN=Pcsk7 PE=1 SV=1 59 628 1.0E-103
sp|Q61139|PCSK7_MOUSE Proprotein convertase subtilisin/kexin type 7 OS=Mus musculus GN=Pcsk7 PE=2 SV=2 59 628 1.0E-103
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 148 666 2.0E-102
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 112 607 7.0E-102
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 64 645 1.0E-101
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 64 645 2.0E-101
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 112 607 4.0E-101
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 100 645 1.0E-100
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 99 628 5.0E-97
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 99 628 5.0E-96
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 138 629 1.0E-91
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 90 487 1.0E-88
sp|P23916|PRCA_ANAVT Calcium-dependent protease OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=prcA PE=1 SV=3 157 612 9.0E-31
sp|Q59149|PRCA_NOSS1 Calcium-dependent protease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prcA PE=3 SV=2 157 612 1.0E-30
sp|P31339|ASPA_AERSA Microbial serine proteinase OS=Aeromonas salmonicida GN=aspA PE=1 SV=1 189 607 2.0E-14
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 531 628 4.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 142 625 5.0E-10
sp|Q00139|VG47_ICHVA Subtilisin-like protease OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF47 PE=3 SV=2 270 606 1.0E-09
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 124 436 1.0E-08
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 157 442 2.0E-08
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 163 423 1.0E-07
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 157 503 1.0E-06
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 177 271 1.0E-06
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 177 473 2.0E-06
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 167 473 4.0E-06
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 159 462 5.0E-06
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 149 471 5.0E-06
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 186 476 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0008236 serine-type peptidase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0004175 endopeptidase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 721 743 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056470
MRLLHPLLAAFLLHSSLAARPAKRSYDTHDYYVIEHIPHASAASLDDVLHALGVEFVEQAGELVNHWLVRTPRNL
HDLSFREEPRDRVVDAFQALRVRAHSSSSKRSTYTDHAHRIVSSIGHLSKQQLRRRVKRAPPPIKPEVSESSRAV
AKRLGIQDPFFEKQWHHVNDEFPEHMMNATPVWEMGYTGKGVISSLVDDGLDYTSDDLAANFDADDSHDFNDHEA
LPTPKNSDDHHGTRCAGQIAAVKNTVCGLGLAYESKVAGVRILSGPITDVDEATALNYGFQNVSIFSCSWGPPDN
GMSMEGPGYLIKKAVVNGINQGRGGKGSIFVFASGNGAASDDQCNFDGYTNSIYSLTVAAIDYKGLHPYYSEACA
ANMVVAYSSGSGQHIVTTDKGKDSCATTHGGTSAAAPNAAGVFVLALQARPDLSWRDIQHLSVETARIVNPDDKD
WEKTATGRLYSYKYGYGAIDAYAFVKAAESWTPVKSQSWIFTETVQLNGGKMPTPSNYTGGQFIGPGGVENKITV
TQQMLEDNNFEKLEHVNVKVWIQHTRRGHVEVEIVSPNGIKSVLASQRQFDNDESGFPGWTFMSVKHWGEDPVGD
WTIRVSDQNEVEKNNGSFLGWNMIFWGSAINTDKTRLFEVEDVEDVLPPTKAPMRPILPSASMTTQYTKPTSHLP
PVDGDMKDENSQPSSPSASPDATATDVPTAPGWFDEMSRLLSNSKWFFGALSLVILFGVGVGVFFCLRRRKRREQ
SSYGRLANDDVSMAGLGNRGGNGRTRELYDAFGEVSEDEEDADETTKLRGTYPPGRSTDGLGFHSGFLDDEEPST
AGGVTPRREHYKDDSSEDGDDTSDSGKEKSKEEIELINTAGPNSPNTRTSGDGSWEHASSATP*
Coding >AgabiH97|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTCCATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
CACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGATGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCA
CTTCCAACCCCAAAAAATTCCGATGACCACCACGGCACAAGATGCGCAGGTCAGATAGCTGCAGTCAAGAACACC
GTATGTGGTCTTGGTCTCGCCTACGAATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTC
GATGAAGCGACTGCGCTCAACTATGGTTTCCAAAATGTATCTATCTTCAGCTGTAGTTGGGGCCCACCTGACAAT
GGTATGTCCATGGAAGGCCCAGGATACCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGG
AAGGGCTCCATTTTCGTCTTCGCCAGTGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACT
AACAGCATATATTCCCTCACGGTTGCTGCGATAGATTACAAGGGTTTACATCCGTATTACTCGGAGGCTTGTGCC
GCTAATATGGTTGTGGCATACAGTTCTGGCAGTGGACAGCACATTGTCACCACTGACAAAGGGAAAGACTCCTGT
GCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAATGCTGCAGGCGTTTTTGTTCTAGCCTTACAGGCTCGA
CCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAGAT
TGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCGTC
AAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTGGA
AAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGGTC
ACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATACC
CGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCCAATGGAATCAAAAGTGTGTTAGCCAGTCAACGTCAGTTC
GACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGGGTGAAGATCCTGTTGGTGAT
TGGACTATTCGTGTTTCCGACCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTC
TGGGGTTCAGCTATCAACACTGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACC
AAGGCGCCTATGCGTCCTATTTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCA
CCTGTTGATGGCGATATGAAAGATGAAAACTCGCAACCTAGTTCCCCATCAGCGAGTCCAGATGCAACTGCCACG
GATGTTCCTACAGCGCCGGGCTGGTTTGACGAAATGTCTAGATTACTTTCAAACAGCAAATGGTTCTTTGGCGCT
TTGTCACTAGTCATCCTCTTTGGAGTAGGCGTAGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAA
AGCTCCTATGGACGGCTCGCGAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGAGGTAACGGGCGTACG
AGGGAATTATATGATGCATTTGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGACTACAAAACTACGTGGA
ACTTACCCTCCTGGACGATCCACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGACGAAGAACCCTCGACC
GCGGGTGGTGTGACGCCACGCCGCGAGCATTATAAGGATGATAGTTCTGAGGATGGTGATGATACCAGTGACTCA
GGAAAAGAGAAGAGTAAAGAGGAAATCGAACTCATTAATACGGCTGGGCCTAATAGTCCAAATACTAGGACGAGT
GGAGACGGTAGCTGGGAACACGCCAGCAGCGCAACACCATAG
Transcript >AgabiH97|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTCCATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
CACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGATGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCA
CTTCCAACCCCAAAAAATTCCGATGACCACCACGGCACAAGATGCGCAGGTCAGATAGCTGCAGTCAAGAACACC
GTATGTGGTCTTGGTCTCGCCTACGAATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTC
GATGAAGCGACTGCGCTCAACTATGGTTTCCAAAATGTATCTATCTTCAGCTGTAGTTGGGGCCCACCTGACAAT
GGTATGTCCATGGAAGGCCCAGGATACCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGG
AAGGGCTCCATTTTCGTCTTCGCCAGTGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACT
AACAGCATATATTCCCTCACGGTTGCTGCGATAGATTACAAGGGTTTACATCCGTATTACTCGGAGGCTTGTGCC
GCTAATATGGTTGTGGCATACAGTTCTGGCAGTGGACAGCACATTGTCACCACTGACAAAGGGAAAGACTCCTGT
GCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAATGCTGCAGGCGTTTTTGTTCTAGCCTTACAGGCTCGA
CCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAGAT
TGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCGTC
AAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTGGA
AAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGGTC
ACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATACC
CGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCCAATGGAATCAAAAGTGTGTTAGCCAGTCAACGTCAGTTC
GACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGGGTGAAGATCCTGTTGGTGAT
TGGACTATTCGTGTTTCCGACCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTC
TGGGGTTCAGCTATCAACACTGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACC
AAGGCGCCTATGCGTCCTATTTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCA
CCTGTTGATGGCGATATGAAAGATGAAAACTCGCAACCTAGTTCCCCATCAGCGAGTCCAGATGCAACTGCCACG
GATGTTCCTACAGCGCCGGGCTGGTTTGACGAAATGTCTAGATTACTTTCAAACAGCAAATGGTTCTTTGGCGCT
TTGTCACTAGTCATCCTCTTTGGAGTAGGCGTAGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAA
AGCTCCTATGGACGGCTCGCGAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGAGGTAACGGGCGTACG
AGGGAATTATATGATGCATTTGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGACTACAAAACTACGTGGA
ACTTACCCTCCTGGACGATCCACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGACGAAGAACCCTCGACC
GCGGGTGGTGTGACGCCACGCCGCGAGCATTATAAGGATGATAGTTCTGAGGATGGTGATGATACCAGTGACTCA
GGAAAAGAGAAGAGTAAAGAGGAAATCGAACTCATTAATACGGCTGGGCCTAATAGTCCAAATACTAGGACGAGT
GGAGACGGTAGCTGGGAACACGCCAGCAGCGCAACACCATAG
Gene >AgabiH97|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTCCATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
CACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGATGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGTGCGCTTTCCCGTTTCTCCTCTGTCCTTGGCACTCACC
CACCATCAAGGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCACTTCCAACCCCAAAAAATTCCGATGA
CCACCACGGCACAAGATGCGCAGGTCAGATAGCTGCAGTCAAGAACACCGTATGTGGTCTTGGTCTCGCCTACGA
ATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTCGATGAAGCGACTGCGCTCAACTATGG
TTTCCAAAATGTATCTATCTTCAGCTGTAGTTGGGGCCCACCTGACAATGGTATGTCCATGGAAGGCCCAGGATA
CCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGGAAGGGCTCCATTTTCGTCTTCGCCAG
TGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACTAACAGCATATATTCCCTCACGGTTGC
TGCGATAGATTACAAGGGTTTACATCCGTATTACTCGGAGGCTTGTGCCGCTAATATGGTTGTGGCATACAGTTC
TGGCAGTGGACAGCACATTGTGATTCATTTTTCCCACCTCGTCGATCAAGCACTTACATCTTCTCTCTCAGGTCA
CCACTGACAAAGGGAAAGACTCCTGTGCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAATGCTGCAGGCG
TTTTTGTTCTAGCCTTACAGGCTCGGTATGATCATATTCACTCTCGAGTAATTCAAGATGCTCATTAATAATCCA
GACCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAG
ATTGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCG
TCAAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTG
GAAAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGG
TCACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATA
CCCGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCCAATGGAATCAAAAGTGTGTTAGCCAGTCAACGTCAGT
TCGACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGTCAGTCTCGCACCTCATTT
CTTCCATGGCCTCGGGCTTATCCGTTATTGTAGGGGTGAAGATCCTGTTGGTGATTGGACTATTCGTGTTTCCGA
CCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTCTGGGGTTCAGCTATCAACAC
TGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACCAAGGCGCCTATGCGTCCTAT
TTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCACCTGTTGATGGCGATATGAA
AGATGAAAACTCGCAACCTAGTTCCCCATCAGCGAGTCCAGATGCAACTGCCACGGATGTTCCTACAGCGCCGGG
CTGGTTTGACGAAATGTCTAGATTACTTTCAAACAGCAAATGGTTCTTTGGCGCTTTGTCACTAGTCATCCTCTT
TGGAGTAGGCGTAGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAAAGCTCCTATGGACGGCTCGC
GAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGAGGTAACGGGCGTACGAGGGAATTATATGATGCATT
TGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGACTACAAAACTACGTGGAACTTACCCTCCTGGACGATC
CACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGACGAAGAACCCTCGACCGCGGGTGGTGTGACGCCACG
CCGCGAGCATTATAAGGATGATAGTTCTGAGGATGGTGATGATACCAGTGACTCAGGAAAAGAGAAGAGTAAAGA
GGAAATCGAACTCATTAATACGGCTGGGCCTAATAGTCCAAATACTAGGACGAGTGGAGACGGTAGCTGGGAACA
CGCCAGCAGCGCAACACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail