Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056390
Gene name
Locationscaffold_3:903296..904058
Strand+
Gene length (bp)762
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 5.0E-07 103 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75UV1|NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus GN=ndx1 PE=1 SV=1 95 199 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056390
MPPSQIIPLQFSSDNFLLAAGGVLFRLAPTAEMNLITPSSSTAPSSFSTSSTSSESISNSPITIDTTPGTSSISN
VTPPTIPAEYNPSDAINRLEICILRNTKTNQFVLPKGRKDVGESLEHAAVREVFEESGFPCELLPCSMSTRAPNP
DLYIGLRPHIEAASQEPFTLTIKTQRDGSLKLIFWYLMRVLSNSAPRMERTQMPNEDFDSMFVGAREGINMLTEP
VYQNIARSAVELVEKAMASTDHCPSFNP*
Coding >AgabiH97|056390
ATGCCTCCATCACAAATCATTCCCCTCCAATTCTCCAGTGATAATTTTCTTCTCGCCGCGGGCGGCGTTCTATTT
CGGCTCGCACCAACAGCCGAAATGAATCTGATTACTCCATCGTCAAGTACAGCGCCAAGTTCATTCTCAACATCA
TCCACTTCCTCCGAATCTATATCCAATTCACCGATCACAATCGACACTACACCGGGAACATCATCTATATCCAAT
GTCACTCCACCAACGATACCCGCGGAATACAATCCTTCCGATGCCATCAATAGGCTCGAAATTTGTATACTTCGT
AATACCAAGACAAATCAATTCGTCCTACCTAAAGGCCGTAAAGATGTGGGGGAGTCTTTAGAGCATGCCGCAGTC
CGCGAGGTCTTTGAAGAATCAGGCTTTCCTTGCGAATTGCTCCCATGTTCCATGTCCACTCGTGCACCCAACCCA
GATCTTTACATTGGTCTCCGTCCACACATTGAAGCCGCTTCTCAGGAACCGTTCACTTTGACAATTAAAACACAA
AGAGATGGAAGTTTGAAGCTGATATTCTGGTATTTGATGCGCGTGCTCAGTAATTCCGCACCAAGGATGGAGAGA
ACACAAATGCCGAATGAAGATTTTGATTCAATGTTCGTGGGGGCGAGGGAAGGAATCAACATGCTGACGGAACCC
GTCTATCAAAACATTGCCAGATCTGCTGTAGAGCTGGTCGAAAAGGCTATGGCTTCTACTGACCACTGCCCCTCA
TTCAATCCGTAA
Transcript >AgabiH97|056390
ATGCCTCCATCACAAATCATTCCCCTCCAATTCTCCAGTGATAATTTTCTTCTCGCCGCGGGCGGCGTTCTATTT
CGGCTCGCACCAACAGCCGAAATGAATCTGATTACTCCATCGTCAAGTACAGCGCCAAGTTCATTCTCAACATCA
TCCACTTCCTCCGAATCTATATCCAATTCACCGATCACAATCGACACTACACCGGGAACATCATCTATATCCAAT
GTCACTCCACCAACGATACCCGCGGAATACAATCCTTCCGATGCCATCAATAGGCTCGAAATTTGTATACTTCGT
AATACCAAGACAAATCAATTCGTCCTACCTAAAGGCCGTAAAGATGTGGGGGAGTCTTTAGAGCATGCCGCAGTC
CGCGAGGTCTTTGAAGAATCAGGCTTTCCTTGCGAATTGCTCCCATGTTCCATGTCCACTCGTGCACCCAACCCA
GATCTTTACATTGGTCTCCGTCCACACATTGAAGCCGCTTCTCAGGAACCGTTCACTTTGACAATTAAAACACAA
AGAGATGGAAGTTTGAAGCTGATATTCTGGTATTTGATGCGCGTGCTCAGTAATTCCGCACCAAGGATGGAGAGA
ACACAAATGCCGAATGAAGATTTTGATTCAATGTTCGTGGGGGCGAGGGAAGGAATCAACATGCTGACGGAACCC
GTCTATCAAAACATTGCCAGATCTGCTGTAGAGCTGGTCGAAAAGGCTATGGCTTCTACTGACCACTGCCCCTCA
TTCAATCCGTAA
Gene >AgabiH97|056390
ATGCCTCCATCACAAATCATTCCCCTCCAATTCTCCAGTGATAATTTTCTTCTCGCCGCGGGCGGCGTTCTATTT
CGGCTCGCACCAACAGCCGAAATGAATCTGATTACTCCATCGTCAAGTACAGCGCCAAGTTCATTCTCAACATCA
TCCACTTCCTCCGAATCTATATCCAATTCACCGATCACAATCGACACTACACCGGGAACATCATCTATATCCAAT
GTCACTCCACCAACGATACCCGCGGAATACAATCCTTCCGATGCCATCAATAGGCTCGAAATTTGTATACTTCGT
AATACCAAGACAAATCAATTCGTCCTACCTAAAGGCCGTAAAGATGTGGGGGAGTCTTTAGAGCATGCCGCAGTC
CGCGAGGTCTTTGAAGAATCAGGCTTTCCTTGCGAATTGCTCCCATGTTCCATGTCCACTCGTGCACCCAACCCA
GATCTTTACATTGGTCTCCGTCCACACATTGAAGCCGCTTCTCAGGAACCGTTCACTTTGACAATTAAAACACAA
AGAGATGGAAGTTTGAAGCTGATATTCTGGTATTTGATGCGCGTGCTCAGTAATTCCGCACCAAGGATGGAGAGA
ACACAAATGCCGAATGAAGATTTTGATTCAATGTTCGTGGGGGCGAGGGAAGGAATCAACATGCTGACGGAACCC
GTCTATCAAAACATTGCCAGATCTGCTGTAGAGCTGGTCGAAAAGGCTATGGCTTCTACTGACCACTGCCCCTCA
TTCAATCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail