Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056280
Gene name
Locationscaffold_3:883526..885368
Strand+
Gene length (bp)1842
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 9.0E-03 45 81
PF00400 WD40 WD domain, G-beta repeat 1.5E-01 152 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78774|ARPC1_SCHPO Actin-related protein 2/3 complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc1 PE=1 SV=3 4 378 7.0E-124
sp|Q9R0Q6|ARC1A_MOUSE Actin-related protein 2/3 complex subunit 1A OS=Mus musculus GN=Arpc1a PE=1 SV=1 1 378 2.0E-115
sp|Q99PD4|ARC1A_RAT Actin-related protein 2/3 complex subunit 1A OS=Rattus norvegicus GN=Arpc1a PE=2 SV=1 1 378 6.0E-115
sp|Q92747|ARC1A_HUMAN Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens GN=ARPC1A PE=1 SV=2 1 378 1.0E-113
sp|Q1JP79|ARC1A_BOVIN Actin-related protein 2/3 complex subunit 1A OS=Bos taurus GN=ARPC1A PE=2 SV=1 1 378 4.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78774|ARPC1_SCHPO Actin-related protein 2/3 complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc1 PE=1 SV=3 4 378 7.0E-124
sp|Q9R0Q6|ARC1A_MOUSE Actin-related protein 2/3 complex subunit 1A OS=Mus musculus GN=Arpc1a PE=1 SV=1 1 378 2.0E-115
sp|Q99PD4|ARC1A_RAT Actin-related protein 2/3 complex subunit 1A OS=Rattus norvegicus GN=Arpc1a PE=2 SV=1 1 378 6.0E-115
sp|Q92747|ARC1A_HUMAN Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens GN=ARPC1A PE=1 SV=2 1 378 1.0E-113
sp|Q1JP79|ARC1A_BOVIN Actin-related protein 2/3 complex subunit 1A OS=Bos taurus GN=ARPC1A PE=2 SV=1 1 378 4.0E-113
sp|O15143|ARC1B_HUMAN Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens GN=ARPC1B PE=1 SV=3 12 382 2.0E-104
sp|Q9WV32|ARC1B_MOUSE Actin-related protein 2/3 complex subunit 1B OS=Mus musculus GN=Arpc1b PE=1 SV=4 12 382 3.0E-104
sp|O88656|ARC1B_RAT Actin-related protein 2/3 complex subunit 1B OS=Rattus norvegicus GN=Arpc1b PE=1 SV=3 12 382 2.0E-103
sp|Q58CQ2|ARC1B_BOVIN Actin-related protein 2/3 complex subunit 1B OS=Bos taurus GN=ARPC1B PE=1 SV=4 12 382 8.0E-101
sp|O96622|ARPC1_DICDI Actin-related protein 2/3 complex subunit 1 OS=Dictyostelium discoideum GN=arcA PE=1 SV=1 13 378 2.0E-99
sp|P38328|ARPC1_YEAST Actin-related protein 2/3 complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC40 PE=1 SV=1 5 382 6.0E-80
sp|Q9SJW6|ARC1B_ARATH Actin-related protein 2/3 complex subunit 1B OS=Arabidopsis thaliana GN=ARPC1B PE=2 SV=1 13 389 1.0E-66
sp|O80856|ARC1A_ARATH Actin-related protein 2/3 complex subunit 1A OS=Arabidopsis thaliana GN=ARPC1A PE=2 SV=1 13 378 2.0E-64
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 36 237 1.0E-08
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 34 237 1.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 34 242 1.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 36 237 2.0E-08
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 36 203 2.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 36 237 2.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 34 237 3.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 34 237 4.0E-08
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 34 237 5.0E-08
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 34 237 8.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 31 184 3.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 36 237 5.0E-07
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 36 259 9.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 9 180 1.0E-06
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 9 180 2.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 50 278 2.0E-06
sp|B3RNR8|CIAO1_TRIAD Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 34 237 3.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 237 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.2986 0.6439 0.1805 0.0326 0.1314 0.057 0.5232 0.273 0.341 0.0539

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup2525
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|056280
Agaricus bisporus var bisporus H97 AgabiH97|056280 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|230_9

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056280
MSPEVFSLSQTPITAHAFSADRKDIAVSLNSNDVQLYTRKGSDWTPTETLSEHDKLITSIDWAPVSNRIVTASQD
RNAYVWTETTDAETGKLIWKPTLVLLRINRAATHVRWSPLENKFAVASGARAIAVCSFDEESNWWVAKHLKKPIR
STVLSVEWHPNNVLLAAGSADMKARVFSGYIKEVDERPAPSVWGSKLPFSTICGEYSSPAGGWVHAVGFSPSGDA
LAFASHDSSITIVYPGGPAIYTIRSPSLPLVTLAWTSEESIVAAGHDCKPLVYAGSEQGWQEVGTLDDSSSSRAS
EGSRSGFGSSSSVGRLKAGAFATFRDADSRGQSSLSGTATGLSDTKLNTIHQNTILSVRPYEVQGGYVTKVSTSA
VDGLSIYLQEAGSETLLYASYYKASWCSTPRAKRPLLHQLPPMISLTGSQCILSVKYQETRLRRLPCT*
Coding >AgabiH97|056280
ATGTCGCCTGAAGTCTTCAGTCTGTCTCAGACTCCCATCACCGCACACGCGTTTAGTGCGGATCGCAAAGATATC
GCCGTCAGCCTAAACAGTAACGACGTTCAACTTTACACGAGAAAGGGCTCGGACTGGACCCCAACAGAGACGCTG
TCTGAGCACGACAAACTGATCACCTCGATCGATTGGGCTCCTGTATCTAACCGCATCGTCACCGCTTCTCAAGAC
AGGAATGCGTATGTTTGGACGGAGACCACAGATGCAGAGACTGGCAAGTTGATTTGGAAGCCGACACTCGTATTG
CTGAGAATCAATCGCGCTGCCACTCATGTTCGTTGGAGCCCCTTAGAAAATAAGTTCGCCGTTGCCAGTGGTGCG
AGAGCGATTGCTGTATGTTCTTTCGATGAAGAGAGCAATTGGTGGGTTGCCAAACACCTCAAGAAACCCATCCGA
TCTACGGTCTTGTCTGTGGAATGGCATCCCAATAATGTTCTGCTGGCAGCTGGTAGTGCTGACATGAAAGCGCGT
GTATTCTCTGGTTATATCAAAGAAGTAGACGAGCGACCAGCTCCCAGTGTCTGGGGTTCCAAATTACCATTCAGT
ACCATTTGCGGAGAATACTCATCTCCTGCAGGAGGATGGGTTCATGCCGTTGGTTTTTCTCCTTCCGGAGACGCC
CTTGCTTTTGCCAGTCACGACAGTTCCATTACAATCGTTTATCCCGGTGGTCCAGCTATCTACACTATCCGCTCT
CCGTCACTCCCTTTGGTCACATTAGCTTGGACCTCTGAAGAGTCAATTGTGGCAGCCGGCCACGACTGCAAACCC
CTAGTTTATGCAGGCTCGGAACAAGGTTGGCAAGAAGTTGGAACATTGGACGACTCGTCATCTTCCCGAGCGTCC
GAAGGATCTCGCTCTGGCTTTGGGAGTAGCAGCAGCGTTGGCCGACTCAAAGCAGGTGCATTTGCTACCTTCCGC
GATGCCGATAGCCGTGGCCAATCGTCTCTAAGTGGTACCGCCACCGGCCTTTCCGATACCAAGCTCAACACAATT
CACCAGAATACAATCCTCAGCGTCCGACCCTATGAAGTTCAAGGTGGTTATGTGACTAAAGTTAGCACCTCCGCT
GTTGATGGTCTATCTATATACCTGCAAGAGGCCGGCTCGGAGACATTGCTATACGCATCCTACTACAAGGCAAGT
TGGTGTTCTACTCCCCGTGCTAAACGACCATTGCTTCATCAACTTCCGCCGATGATATCTCTAACAGGTTCCCAA
TGCATCTTATCAGTGAAATATCAAGAGACCCGTCTCAGAAGACTGCCATGCACTTAG
Transcript >AgabiH97|056280
ATGTCGCCTGAAGTCTTCAGTCTGTCTCAGACTCCCATCACCGCACACGCGTTTAGTGCGGATCGCAAAGATATC
GCCGTCAGCCTAAACAGTAACGACGTTCAACTTTACACGAGAAAGGGCTCGGACTGGACCCCAACAGAGACGCTG
TCTGAGCACGACAAACTGATCACCTCGATCGATTGGGCTCCTGTATCTAACCGCATCGTCACCGCTTCTCAAGAC
AGGAATGCGTATGTTTGGACGGAGACCACAGATGCAGAGACTGGCAAGTTGATTTGGAAGCCGACACTCGTATTG
CTGAGAATCAATCGCGCTGCCACTCATGTTCGTTGGAGCCCCTTAGAAAATAAGTTCGCCGTTGCCAGTGGTGCG
AGAGCGATTGCTGTATGTTCTTTCGATGAAGAGAGCAATTGGTGGGTTGCCAAACACCTCAAGAAACCCATCCGA
TCTACGGTCTTGTCTGTGGAATGGCATCCCAATAATGTTCTGCTGGCAGCTGGTAGTGCTGACATGAAAGCGCGT
GTATTCTCTGGTTATATCAAAGAAGTAGACGAGCGACCAGCTCCCAGTGTCTGGGGTTCCAAATTACCATTCAGT
ACCATTTGCGGAGAATACTCATCTCCTGCAGGAGGATGGGTTCATGCCGTTGGTTTTTCTCCTTCCGGAGACGCC
CTTGCTTTTGCCAGTCACGACAGTTCCATTACAATCGTTTATCCCGGTGGTCCAGCTATCTACACTATCCGCTCT
CCGTCACTCCCTTTGGTCACATTAGCTTGGACCTCTGAAGAGTCAATTGTGGCAGCCGGCCACGACTGCAAACCC
CTAGTTTATGCAGGCTCGGAACAAGGTTGGCAAGAAGTTGGAACATTGGACGACTCGTCATCTTCCCGAGCGTCC
GAAGGATCTCGCTCTGGCTTTGGGAGTAGCAGCAGCGTTGGCCGACTCAAAGCAGGTGCATTTGCTACCTTCCGC
GATGCCGATAGCCGTGGCCAATCGTCTCTAAGTGGTACCGCCACCGGCCTTTCCGATACCAAGCTCAACACAATT
CACCAGAATACAATCCTCAGCGTCCGACCCTATGAAGTTCAAGGTGGTTATGTGACTAAAGTTAGCACCTCCGCT
GTTGATGGTCTATCTATATACCTGCAAGAGGCCGGCTCGGAGACATTGCTATACGCATCCTACTACAAGGCAAGT
TGGTGTTCTACTCCCCGTGCTAAACGACCATTGCTTCATCAACTTCCGCCGATGATATCTCTAACAGGTTCCCAA
TGCATCTTATCAGTGAAATATCAAGAGACCCGTCTCAGAAGACTGCCATGCACTTAG
Gene >AgabiH97|056280
ATGTCGCCTGAAGTCTTCAGTCTGTCTCAGACTCCCATCACCGCACACGCGTTTAGTGCGGATCGCAAAGGTTCA
CTTAACCTCTACGTCTCTACTACAACCTTTGACCTTTCTCCAGATATCGCCGTCAGCCTAAACAGTAACGACGTT
CAACTTTACACGAGAAAGGGCTCGGACTGGACCCCAACAGAGACGCTGTCTGAGGTACTGTCTGATATTCGCCGC
CTCTTTTCTTGGAACTAACAGTCAATCTCAGCACGACAAACTGATCACCTCGATCGATTGGGCTCCTGTATCTAA
CCGCATCGTCACCGCTTCTCAAGACAGGAATGCGTATGTTTGGACGGAGACCACAGATGCAGAGACTGGCAAGTT
GATTTGGAAGCCGACACTCGTATTGCTGAGAATCAATCGCGCTGCCACTCATGTTCGTTGGAGCCCCTTAGAAAA
TAAGTTCGCCGTTGCCAGTGGTGCGAGGTGCGTATATATTTATCAATGTCTGGTATGAAATGCTCAAGCGCGGAT
GTATTCAGAGCGATTGCTGTATGTTCTTTCGATGAAGAGAGCAATTGGTGGGTTGCCAAACACCTCAAGAAACCC
ATCCGATCTACGGTCTTGTCTGTGGAATGGCATCCCAATAATGTTCTGCTGGCAGCTGGTAGTGCTGACATGAAA
GCGCGTGTATTCTCTGGTTATATCAAAGAAGTAGACGAGCGGTAAGGATTGAAAGTATTGGTCTCGATACACATT
AATGTTTCTTCTAGACCAGCTCCCAGTGTCTGGGGTTCCAAATTACCATTCAGTACCATTTGCGGAGAATACTCA
TCTCCTGCAGGAGGATGGGTTCATGCCGTTGGTTTTTCTCCTTCCGGAGACGCCCTTGCTTTTGCCAGTACGTCC
TACCTCTACGCTTAACGTTGTCAAAATTTTTGATGGTTTATAGGTCACGACAGTTCCATTACAATCGTTTATCCC
GGTGGTCCAGCTATCTACACTATCCGCTCTCCGTCACTCCCTTTGGTCACATTAGCTTGGACCTCTGAAGAGTCA
ATTGTGGCAGCCGGCCACGACTGCAAACCCCTAGTTTATGCAGGCTCGGAACAAGGTTGGCAAGAAGTTGGAACA
TTGGACGACTCGTCATCTTCCCGAGCGTCCGAAGGATCTCGCTCTGGCTTTGGGAGTAGCAGCAGCGTTGGCCGA
CTCAAAGCAGGTGCATTTGCTACCTTCCGCGATGCCGATAGCCGTGGCCAATCGTCTCTAAGTGGTACCGCCACC
GGCCTTTCCGATACCAAGCTCAACACAATTCACCAGAATACAATCCTCAGCGTCCGACCCTATGAAGTTCAAGGT
GGTTATGTGACTAAAGTTAGCACCTCCGCTGTTGATGGTACGCTAGTCATCTGGGATACAAATGAAGTCAGCGCA
TTGGCTGGAAAGATGGGTGGCGTAAAGATTTAGAAATTTCGTTACCCTCCTCTTCTTGTCAGTGGCAATAGCTTC
AATATCTGGTTACTCCACAATTACCGAAATGAAATAGAAATAGTGCACATTTTAAGAGTCAGAATAATGGATGAC
CGTCTGTAAGGTCTATCTATATACCTGCAAGAGGCCGGCTCGGAGACATTGCTATACGCATCCTACTACAAGGCA
AGTTGGTGTTCTACTCCCCGTGCTAAACGACCATTGCTTCATCAAGTAAGTGCGCATCTGAACGTCTAGGATATG
TACAACAAAAATCTGATGATTCACCAGCTTCCGCCGATGATATCTCTAACAGGTTCCCAATGCATCTTATCAGTG
AAATATCAAGAGACCCGTCTCAGAAGACTGCCATGCACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail