Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056220
Gene name
Locationscaffold_3:865448..868115
Strand+
Gene length (bp)2667
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 2.2E-28 440 573
PF13696 zf-CCHC_2 Zinc knuckle 3.7E-10 370 389
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 9.2E-12 603 670
PF00098 zf-CCHC Zinc knuckle 4.2E-03 375 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q84WU9|C3H64_ARATH Zinc finger CCCH domain-containing protein 64 OS=Arabidopsis thaliana GN=At5g56900 PE=2 SV=1 7 671 4.0E-56
sp|Q69NK8|C3H59_ORYSJ Zinc finger CCCH domain-containing protein 59 OS=Oryza sativa subsp. japonica GN=Os09g0364000 PE=2 SV=1 7 672 4.0E-55
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 442 670 6.0E-44
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 429 673 3.0E-38
sp|Q5R8R4|C19L1_PONAB CWF19-like protein 1 OS=Pongo abelii GN=CWF19L1 PE=2 SV=1 448 673 6.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q84WU9|C3H64_ARATH Zinc finger CCCH domain-containing protein 64 OS=Arabidopsis thaliana GN=At5g56900 PE=2 SV=1 7 671 4.0E-56
sp|Q69NK8|C3H59_ORYSJ Zinc finger CCCH domain-containing protein 59 OS=Oryza sativa subsp. japonica GN=Os09g0364000 PE=2 SV=1 7 672 4.0E-55
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 442 670 6.0E-44
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 429 673 3.0E-38
sp|Q5R8R4|C19L1_PONAB CWF19-like protein 1 OS=Pongo abelii GN=CWF19L1 PE=2 SV=1 448 673 6.0E-37
sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens GN=CWF19L1 PE=1 SV=2 448 673 1.0E-36
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 448 673 2.0E-35
sp|Q5RGJ5|C19L1_DANRE CWF19-like protein 1 OS=Danio rerio GN=cwf19l1 PE=2 SV=1 430 673 3.0E-33
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 1 352 1.0E-25
sp|O16216|C19L1_CAEEL CWF19-like protein 1 homolog OS=Caenorhabditis elegans GN=F17A9.2 PE=3 SV=2 435 670 1.0E-25
sp|P53255|DRN1_YEAST CWF19-like protein DRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRN1 PE=1 SV=1 430 673 6.0E-25
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 428 670 3.0E-24
sp|O16216|C19L1_CAEEL CWF19-like protein 1 homolog OS=Caenorhabditis elegans GN=F17A9.2 PE=3 SV=2 1 285 3.0E-22
sp|Q5RGJ5|C19L1_DANRE CWF19-like protein 1 OS=Danio rerio GN=cwf19l1 PE=2 SV=1 1 311 6.0E-19
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 8 302 7.0E-19
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 1 300 1.0E-18
sp|Q5R8R4|C19L1_PONAB CWF19-like protein 1 OS=Pongo abelii GN=CWF19L1 PE=2 SV=1 1 346 1.0E-16
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 1 345 2.0E-16
sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens GN=CWF19L1 PE=1 SV=2 1 346 4.0E-15
sp|Q2TBE0|C19L2_HUMAN CWF19-like protein 2 OS=Homo sapiens GN=CWF19L2 PE=1 SV=4 436 670 1.0E-12
sp|Q28C44|C19L2_XENTR CWF19-like protein 2 OS=Xenopus tropicalis GN=cwf19l2 PE=2 SV=1 446 670 2.0E-12
sp|Q8BG79|C19L2_MOUSE CWF19-like protein 2 OS=Mus musculus GN=Cwf19l2 PE=1 SV=1 414 670 8.0E-12
sp|Q3LSS0|C19L2_DANRE CWF19-like protein 2 OS=Danio rerio GN=cwf19l2 PE=2 SV=1 416 670 9.0E-09
sp|P53255|DRN1_YEAST CWF19-like protein DRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRN1 PE=1 SV=1 5 335 6.0E-08
sp|Q10946|C19L2_CAEEL CWF19-like protein 2 homolog OS=Caenorhabditis elegans GN=B0361.2/B0361.1 PE=3 SV=2 446 670 9.0E-07
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 347 437 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056220
MDSNSVKILTLGAAAGSIREILSKIKVIDDKHGKFDFVLCTGDFFGLLDESTESDIDDDEVSLLLDGKLEVPVEC
YIMQGKYPLPPKVIQKFSKTGGELCSNMFLMGKSGTITTANGIRIACLGGVYDAEIYSSVDAAPGFVSPYFSTHT
KERLLANCFSTVSTTQSYNSLASIQSNLPPSQLVDILLSNMWPSRIAHSSACPVPQNELFPIIAPPLDEIVRRIR
PRYHFTTGGGSPPFFWEREPFVWDEEEGRVMRFISLGAFGGGTLSSGKKQRWFYAFSISPKPTSSPLLPSNVTSN
PFTEPTNRGFKRSFETSEGTNFIFGDVRQPVKRNRIVQGDPGKPPPGYKCRRCESIDHFIIDCPERSKPPEGYIC
KLCTEPGHFVRDCPSRDAVGDTGGRKPKPGYVCRACGSEEHYLDDCLTNRSAQKGDRRPGHRGPAREIAPDECWF
CLSNPNLAKHLIVSIGSEVYVTLPKGQIVPTQSTSDPMSIPGGGHVLIVPITHYPTYTTIPPELAPPIMEETEKY
KSALRAFFSKHGCSFVMFEVGRLSTKGGHAHVQVVPIPRALEDRVEDEFIREGRAVGIDFERDAEEAMNLCAGGK
GGYFKVELPDGRKMVHLIREHVPFNLQFGRQVLVTLLGVPDRLDWKACTLSDEEDRKDAQAFKTAFAPFDPSL*
Coding >AgabiH97|056220
ATGGACTCAAACTCAGTCAAAATACTTACCCTAGGCGCTGCAGCAGGTTCCATACGCGAAATCCTATCAAAAATA
AAAGTAATTGACGACAAGCATGGCAAATTTGACTTTGTGCTGTGTACTGGCGATTTTTTCGGGTTACTAGATGAA
TCAACCGAGTCAGATATCGACGACGATGAGGTCTCTCTTTTGCTTGACGGAAAATTGGAGGTGCCTGTAGAGTGC
TATATCATGCAGGGCAAGTATCCACTGCCACCCAAAGTCATACAGAAGTTTTCTAAGACTGGAGGGGAACTTTGC
AGTAACATGTTTCTGATGGGCAAATCCGGAACAATCACTACAGCCAATGGCATACGAATCGCGTGTCTTGGAGGC
GTGTATGATGCAGAGATTTACAGTTCAGTCGACGCTGCTCCAGGTTTTGTCTCCCCCTACTTCTCTACTCACACG
AAAGAACGTTTGCTTGCAAATTGTTTTTCAACTGTTTCAACAACTCAAAGTTACAACTCCCTTGCGTCCATCCAG
TCAAACTTGCCGCCTTCACAATTGGTTGATATTCTGCTGAGCAATATGTGGCCTTCCCGCATCGCACATTCATCA
GCATGTCCAGTTCCTCAAAATGAACTCTTCCCAATCATCGCCCCACCTCTCGACGAAATTGTACGGCGTATACGA
CCGCGATATCACTTCACCACAGGCGGAGGGTCGCCTCCCTTTTTCTGGGAGCGTGAGCCCTTCGTTTGGGATGAA
GAGGAAGGTCGCGTGATGCGGTTCATCTCTCTAGGCGCCTTTGGTGGTGGGACACTATCGTCAGGCAAGAAACAG
AGATGGTTTTATGCTTTCAGCATCTCTCCGAAACCGACTTCAAGTCCTCTTCTACCTTCCAATGTGACCAGTAAT
CCATTTACCGAACCCACCAATAGGGGATTTAAACGTTCATTCGAAACGTCTGAGGGCACTAACTTCATTTTTGGC
GACGTCCGTCAGCCGGTGAAAAGGAACAGAATTGTGCAAGGAGATCCTGGGAAACCGCCCCCTGGTTACAAATGT
CGTCGTTGTGAATCAATAGATCATTTTATTATCGATTGTCCGGAACGCTCAAAACCTCCTGAAGGTTATATTTGC
AAGCTCTGTACAGAGCCTGGTCATTTCGTTCGCGACTGTCCCTCGAGGGATGCCGTCGGAGATACAGGTGGTCGT
AAACCCAAACCCGGATATGTTTGTCGCGCATGTGGCAGTGAAGAACACTATCTTGACGATTGTTTGACCAACCGA
TCAGCACAAAAGGGTGACAGACGACCTGGTCATAGAGGTCCGGCCAGAGAGATTGCTCCTGATGAATGTTGGTTT
TGTTTATCAAATCCTAACCTCGCAAAACATCTCATCGTTTCGATTGGATCCGAGGTCTATGTGACTCTGCCCAAA
GGTCAAATAGTTCCCACTCAATCGACGTCTGATCCTATGAGCATTCCCGGTGGTGGCCACGTTCTGATCGTTCCC
ATCACGCACTATCCGACTTACACGACAATTCCTCCCGAATTAGCTCCTCCGATAATGGAAGAAACTGAAAAATAC
AAGTCAGCACTGAGAGCATTTTTCAGCAAGCATGGCTGTAGTTTTGTGATGTTCGAGGTTGGGCGACTGAGCACC
AAAGGGGGCCATGCCCATGTACAAGTTGTGCCTATACCCCGAGCACTTGAAGACCGAGTAGAGGACGAATTTATC
CGTGAGGGTCGGGCTGTGGGAATAGATTTTGAACGAGACGCTGAGGAGGCCATGAATCTCTGTGCTGGTGGTAAA
GGTGGCTACTTTAAGGTTGAATTGCCCGATGGCAGGAAAATGGTTCACCTCATCAGGGAGCACGTTCCTTTCAAT
CTACAATTTGGACGGCAAGTACTTGTTACACTGTTGGGTGTACCAGATAGATTGGATTGGAAGGCGTGCACATTA
TCCGATGAAGAGGATCGCAAAGATGCGCAGGCTTTCAAGACAGCTTTTGCTCCATTTGACCCAAGTTTATAA
Transcript >AgabiH97|056220
ATGGACTCAAACTCAGTCAAAATACTTACCCTAGGCGCTGCAGCAGGTTCCATACGCGAAATCCTATCAAAAATA
AAAGTAATTGACGACAAGCATGGCAAATTTGACTTTGTGCTGTGTACTGGCGATTTTTTCGGGTTACTAGATGAA
TCAACCGAGTCAGATATCGACGACGATGAGGTCTCTCTTTTGCTTGACGGAAAATTGGAGGTGCCTGTAGAGTGC
TATATCATGCAGGGCAAGTATCCACTGCCACCCAAAGTCATACAGAAGTTTTCTAAGACTGGAGGGGAACTTTGC
AGTAACATGTTTCTGATGGGCAAATCCGGAACAATCACTACAGCCAATGGCATACGAATCGCGTGTCTTGGAGGC
GTGTATGATGCAGAGATTTACAGTTCAGTCGACGCTGCTCCAGGTTTTGTCTCCCCCTACTTCTCTACTCACACG
AAAGAACGTTTGCTTGCAAATTGTTTTTCAACTGTTTCAACAACTCAAAGTTACAACTCCCTTGCGTCCATCCAG
TCAAACTTGCCGCCTTCACAATTGGTTGATATTCTGCTGAGCAATATGTGGCCTTCCCGCATCGCACATTCATCA
GCATGTCCAGTTCCTCAAAATGAACTCTTCCCAATCATCGCCCCACCTCTCGACGAAATTGTACGGCGTATACGA
CCGCGATATCACTTCACCACAGGCGGAGGGTCGCCTCCCTTTTTCTGGGAGCGTGAGCCCTTCGTTTGGGATGAA
GAGGAAGGTCGCGTGATGCGGTTCATCTCTCTAGGCGCCTTTGGTGGTGGGACACTATCGTCAGGCAAGAAACAG
AGATGGTTTTATGCTTTCAGCATCTCTCCGAAACCGACTTCAAGTCCTCTTCTACCTTCCAATGTGACCAGTAAT
CCATTTACCGAACCCACCAATAGGGGATTTAAACGTTCATTCGAAACGTCTGAGGGCACTAACTTCATTTTTGGC
GACGTCCGTCAGCCGGTGAAAAGGAACAGAATTGTGCAAGGAGATCCTGGGAAACCGCCCCCTGGTTACAAATGT
CGTCGTTGTGAATCAATAGATCATTTTATTATCGATTGTCCGGAACGCTCAAAACCTCCTGAAGGTTATATTTGC
AAGCTCTGTACAGAGCCTGGTCATTTCGTTCGCGACTGTCCCTCGAGGGATGCCGTCGGAGATACAGGTGGTCGT
AAACCCAAACCCGGATATGTTTGTCGCGCATGTGGCAGTGAAGAACACTATCTTGACGATTGTTTGACCAACCGA
TCAGCACAAAAGGGTGACAGACGACCTGGTCATAGAGGTCCGGCCAGAGAGATTGCTCCTGATGAATGTTGGTTT
TGTTTATCAAATCCTAACCTCGCAAAACATCTCATCGTTTCGATTGGATCCGAGGTCTATGTGACTCTGCCCAAA
GGTCAAATAGTTCCCACTCAATCGACGTCTGATCCTATGAGCATTCCCGGTGGTGGCCACGTTCTGATCGTTCCC
ATCACGCACTATCCGACTTACACGACAATTCCTCCCGAATTAGCTCCTCCGATAATGGAAGAAACTGAAAAATAC
AAGTCAGCACTGAGAGCATTTTTCAGCAAGCATGGCTGTAGTTTTGTGATGTTCGAGGTTGGGCGACTGAGCACC
AAAGGGGGCCATGCCCATGTACAAGTTGTGCCTATACCCCGAGCACTTGAAGACCGAGTAGAGGACGAATTTATC
CGTGAGGGTCGGGCTGTGGGAATAGATTTTGAACGAGACGCTGAGGAGGCCATGAATCTCTGTGCTGGTGGTAAA
GGTGGCTACTTTAAGGTTGAATTGCCCGATGGCAGGAAAATGGTTCACCTCATCAGGGAGCACGTTCCTTTCAAT
CTACAATTTGGACGGCAAGTACTTGTTACACTGTTGGGTGTACCAGATAGATTGGATTGGAAGGCGTGCACATTA
TCCGATGAAGAGGATCGCAAAGATGCGCAGGCTTTCAAGACAGCTTTTGCTCCATTTGACCCAAGTTTATAA
Gene >AgabiH97|056220
ATGGACTCAAACTCAGTCAAAATGTGAGACCAAACATTTGGATCACTGCGACTAACTAAAGCATGCCAGACTTAC
CCTAGGCGCTGCAGCAGGTTCCATACGCGAAATCCTATCAAAAATAAAAGTAATTGACGACAAGCATGGCAAATT
TGACTTTGTGCTGTGTACTGGCGATTTTTTCGGGTTACTAGATGAATCAACCGAGTCAGATATCGACGACGATGA
GGTCTCTCTTTTGCTTGACGGAAAATTGGAGGGTATGTTGTGAAATCTGTTACATTGGTGCACTCAAAAATTGAC
GAAATCTCAGTGCCTGTAGAGTGCTATATCATGCAGGGCAAGTATCCACTGCCACCCAAAGTCATACAGAAGTTT
TCTAAGACTGGAGGGGAACTTTGCAGTAACATGTTTCTGATGGGTGAGCAAATCTAGCAAATACGCCAGGTGGTT
TCATCCTCATGATTATCCCAGGCAAATCCGGAACAATCACTACAGCCAATGGCATACGAATCGCGTGTCTTGGAG
GCGTGTATGATGCAGAGATTTACAGTTCAGTCGACGCTGCTCCAGTGAGTTGAACATCCGTTTCGTGGTCCATCG
TCATTGACTTCTTGCAGGGTTTTGTCTCCCCCTACTTCTCTACTCACACGAAAGAACGTTTGCTTGCAAATTGTT
TTTCAACTGTTTCAACAACTCAAAGTTACAACTCCCTTGCGTCCATCCAGTCAAACTTGCCGCCTTCACAATTGG
TTGATATTCTGCTGAGCAATATGTGGCCTTCCCGCATCGCACATTCATCAGCATGTCCAGTTCCTCAAAATGAAC
TCTTCCCAATCATCGCCCCACCTCTCGACGAAATTGTACGGCGTATACGACCGCGATATCACTTCACCACAGGCG
GAGGGTCGCCTCCCTTTTTCTGGGAGCGTGAGCCCTTCGTTTGGGATGAAGAGGAAGGTCGCGTGATGCGGTTCA
TCTCTCTAGGCGCCTTTGGTGGTGGGACACTATCGTCAGGCAAGAAACAGAGAGTACGTCTCATCACTGACTACA
TCGTACGCCGACAATTCTTTGTTTAATATCTTATTTCAGTGGTTTTATGCTTTCAGCATCTCTCCGAAACCGACT
TCAAGTCCTCTTCTACCTTCCAATGTGACCAGTAATCCATTTACCGAACCCACCAATAGGGGATTTAAACGTTCA
TTCGAAACGTCTGAGGGCACTAACTTCATTTTTGGCGACGTCCGTCAGCCGGTGAAAAGGAACAGAATTGGTGAG
ACTCAGATTTCCAATCATTTCGGGTTGTTAATATCTCTCAGTGCAAGGAGATCCTGGGAAACCGCCCCCTGGTTA
CAAATGTCGTCGTTGTGAATCAATAGATGTACCGATATTTTTGCTATGCTTGAACTATCACTGACCTTGATGTCA
GCATTTTATTATCGATTGTCCGGAACGCTCAAAACCTCCTGAAGGTTATATTTGCAAGCTCTGTACAGAGGTACA
TTCAATTTCCCAATGAAAATGGCTAATGTGATCTTACCACTCGCATAGCCTGGTCATTTCGTTCGCGACTGTCCC
TCGAGGGATGCCGTCGGAGATACAGGTGGTCGTAAACCCAAACCCGGATATGTTTGTCGCGCATGTGGCAGTGAA
GAACACTATCTTGACGATTGTTTGACCAACCGATCAGCACAAAAGGGTGACAGACGACCTGGTCATAGAGGTCCG
GCCAGAGAGATTGCTCGTGAGTGTTCCGCAGGGTTAGTCAATAGTTATGGTACAGGTTCTAATCAGTTACTTTCT
ACGGCCCTCAGCTGATGAATGTTGGTTTTGTTTATCAAATCCTAACCTCGCGTGAGTCGATTGTCTTGTTTCTCG
ATGCACATATTAAACAAAGTTTAGAAAACATCTCATCGTTTCGATTGGATCCGAGGTCTATGTGACTCTGCCCAA
AGGTCAAATAGTTCCCACTCAATCGACGTCTGATCCTATGAGCATTCCCGGTGGTGGCCACGTTCTGATCGTTCC
CATCACGCACTATCCGACTTACACGACAATTCCTCCCGAATTAGCTCCTCCGATAATGGAAGAAACTGAAAAGTA
GGTCCATCATAATTTCTTTCGAATTCTATCTCTCATAATTTTTCAGATACAAGTCAGCACTGAGAGCATTTTTCA
GCAAGCATGGCTGTAGTTTTGTGATGTTCGAGGTTGGGCGACTGAGCACCAAAGGGGGCCATGCCCATGTACAAG
TTGTGCCTATACCCCGAGCACTTGAAGACCGAGTAGAGGACGAATTTATCCGTGAGGGTCGGGCTGTGGGAATAG
ATTTTGAACGAGACGCTGAGGAGGCCATGAATCTCTGTGCTGGTGGTAAAGGTGGCTACTTTAAGGTTGAATTGC
CCGATGGCAGGAAAATGGTTCACCTCATCAGGGAGCACGTTCCTTTCAATCTACAATTTGGACGGTGCGTGGCTG
TACAAAATGTTCCCGAATAATGCCACTGATATTAGATTGCGTGTTTCGTTCGTGACAAGGCAAGTACTTGTTACA
CTGTTGGGTGTACCAGATAGATTGGATTGGAAGGCGTGCACATTATCCGATGAAGAGGATCGCAAAGATGCGCAG
GCTTTCAAGACAGCTTTTGCTCCATTTGACCCAAGTTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail