Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056200
Gene name
Locationscaffold_3:860111..861694
Strand+
Gene length (bp)1583
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 1.1E-10 71 192

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5PQ50|NUD19_XENLA Nucleoside diphosphate-linked moiety X motif 19 OS=Xenopus laevis GN=nudt19 PE=2 SV=1 85 265 2.0E-11
sp|P91148|NDX7_CAEEL Putative nudix hydrolase 7 OS=Caenorhabditis elegans GN=ndx-7 PE=3 SV=2 72 307 7.0E-11
sp|Q7M0H3|NUD19_MUSCR Nucleoside diphosphate-linked moiety X motif 19 OS=Mus caroli GN=Nudt19 PE=2 SV=1 113 259 6.0E-08
sp|P11930|NUD19_MOUSE Nucleoside diphosphate-linked moiety X motif 19 OS=Mus musculus GN=Nudt19 PE=1 SV=2 113 264 8.0E-08
sp|Q23236|NDX3_CAEEL Nudix hydrolase 3 OS=Caenorhabditis elegans GN=ndx-3 PE=3 SV=2 48 131 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056200
MPHHSFYNTFIWVLLPAKSQSCIKLAHFGLPSRSAPACFVIEVSEAQPSALYSRLIMSSTSANSENPVAVPRPSA
SLIVVNERNEILLVHRNPKARSFGGMTVFPGGNYDKKQDTTLAVTAIRETFEETGLLLVSSDEPSTTAPLDDAQL
EDARHRIHQQKLLWQEFLDSRRLRLDVSALLPFTQWITPKEAPRRFHTQFFITFLPATPSTGFNSGAKHEHIPKT
DGGQEVISTRFVHPSAILREFHDGKITLLPPQFYLLTTLVDVLQGVSNTEKQRMRVEHISRSNFGRMTFNPRPLK
TEGEDRVQGQLILTYEGDETRGGSPGRLHRANLRMANGLIREIVLQRNFDIYDNVDSHAHNFSQSSKL*
Coding >AgabiH97|056200
ATGCCGCACCACTCCTTCTACAATACCTTCATTTGGGTTTTACTTCCAGCCAAGTCGCAGTCCTGCATCAAACTC
GCTCATTTTGGGCTCCCTAGTCGGAGCGCCCCTGCGTGTTTTGTAATTGAGGTGTCCGAAGCCCAACCGAGCGCG
CTGTACTCGCGATTGATAATGTCCTCAACTTCTGCCAACTCTGAAAACCCCGTGGCAGTCCCACGGCCGTCGGCA
AGCCTAATCGTAGTCAATGAGCGCAATGAGATTCTGCTGGTTCACCGGAACCCTAAAGCGCGTTCGTTCGGTGGA
ATGACTGTCTTTCCTGGCGGAAACTATGACAAGAAGCAGGACACAACTTTGGCAGTCACCGCAATCCGAGAAACT
TTTGAAGAAACAGGACTTCTACTTGTTTCTTCTGACGAGCCCTCCACAACGGCGCCCCTCGACGACGCTCAATTG
GAAGACGCGCGTCATCGCATCCACCAGCAGAAGCTACTATGGCAGGAGTTCCTTGATTCTCGCCGTCTGAGATTA
GATGTTAGTGCACTCTTACCTTTTACGCAATGGATCACTCCCAAAGAAGCGCCACGCCGGTTCCATACACAATTC
TTTATCACATTCCTGCCTGCTACACCTTCAACAGGTTTTAATTCTGGAGCAAAGCATGAACACATTCCCAAAACA
GATGGAGGCCAAGAGGTCATCTCCACGAGATTCGTTCACCCTAGCGCGATTTTACGCGAGTTCCATGACGGCAAA
ATTACCCTCTTGCCACCTCAATTCTACCTCCTTACAACACTTGTCGATGTACTTCAAGGAGTATCAAATACCGAG
AAGCAAAGGATGCGAGTGGAGCACATATCTCGAAGCAATTTTGGTCGCATGACATTTAATCCCCGTCCGCTCAAA
ACAGAGGGCGAGGATCGTGTCCAGGGCCAGTTAATACTCACGTATGAAGGCGACGAAACTCGAGGAGGTTCGCCC
GGACGCTTACATCGTGCAAATTTACGGATGGCTAACGGGTTAATTAGAGAGATCGTCCTTCAACGCAACTTTGAT
ATCTATGACAATGTTGATTCGCATGCGCATAACTTTTCTCAATCTTCCAAACTTTAG
Transcript >AgabiH97|056200
ATGCCGCACCACTCCTTCTACAATACCTTCATTTGGGTTTTACTTCCAGCCAAGTCGCAGTCCTGCATCAAACTC
GCTCATTTTGGGCTCCCTAGTCGGAGCGCCCCTGCGTGTTTTGTAATTGAGGTGTCCGAAGCCCAACCGAGCGCG
CTGTACTCGCGATTGATAATGTCCTCAACTTCTGCCAACTCTGAAAACCCCGTGGCAGTCCCACGGCCGTCGGCA
AGCCTAATCGTAGTCAATGAGCGCAATGAGATTCTGCTGGTTCACCGGAACCCTAAAGCGCGTTCGTTCGGTGGA
ATGACTGTCTTTCCTGGCGGAAACTATGACAAGAAGCAGGACACAACTTTGGCAGTCACCGCAATCCGAGAAACT
TTTGAAGAAACAGGACTTCTACTTGTTTCTTCTGACGAGCCCTCCACAACGGCGCCCCTCGACGACGCTCAATTG
GAAGACGCGCGTCATCGCATCCACCAGCAGAAGCTACTATGGCAGGAGTTCCTTGATTCTCGCCGTCTGAGATTA
GATGTTAGTGCACTCTTACCTTTTACGCAATGGATCACTCCCAAAGAAGCGCCACGCCGGTTCCATACACAATTC
TTTATCACATTCCTGCCTGCTACACCTTCAACAGGTTTTAATTCTGGAGCAAAGCATGAACACATTCCCAAAACA
GATGGAGGCCAAGAGGTCATCTCCACGAGATTCGTTCACCCTAGCGCGATTTTACGCGAGTTCCATGACGGCAAA
ATTACCCTCTTGCCACCTCAATTCTACCTCCTTACAACACTTGTCGATGTACTTCAAGGAGTATCAAATACCGAG
AAGCAAAGGATGCGAGTGGAGCACATATCTCGAAGCAATTTTGGTCGCATGACATTTAATCCCCGTCCGCTCAAA
ACAGAGGGCGAGGATCGTGTCCAGGGCCAGTTAATACTCACGTATGAAGGCGACGAAACTCGAGGAGGTTCGCCC
GGACGCTTACATCGTGCAAATTTACGGATGGCTAACGGGTTAATTAGAGAGATCGTCCTTCAACGCAACTTTGAT
ATCTATGACAATGTTGATTCGCATGCGCATAACTTTTCTCAATCTTCCAAACTTTAG
Gene >AgabiH97|056200
ATGCCGCACCACTCCTTCTACAATACCTTCATTTGGGTTTTACTTCCAGCCAAGTCGCAGTCCTGCATCAAACTC
GCTCATTTTGGGCTCCCTAGTCGGAGCGCCCCTGCGTGTTTTGTAATTGAGGTGTCCGAAGCCCAACCGAGCGCG
CTGTACTCGTAATCAGCTTTTAACTTAAATCCGGTTCTTTGTTGATGTTCAAATATTTGACTGCGTAGGCGGTAT
ACCCTATTTTTATCACGAGACAAATTCCGAACATCTCTTGCATTATAAGATGTGGATCGCTATGCAGGCACGCCC
TGTCCAGCCCTCCTGTTTTTCACTATCCATTCCACGAAACAAGTTTATCTGGCGATCCCCTCACTCCTCGCCGCG
TACACGTAGATTGATAATGTCCTCAACTTCTGCCAACTCTGAAAACCCCGTGGCAGTCCCACGGCCGTCGGCAAG
CCTAATCGTAGTCAATGAGCGCAATGAGATTCTGCTGGTTCACCGGAACCCTAAAGCGCGTTCGTTCGGTGGAAT
GACTGTGAGTTGCCGATGTGCCTTTTCATTTATATTTCCAGTCTGTGACGGCAGTTGTCTTTCTCGTCCTAGGTC
TTTCCTGGCGGAAACTATGACAAGAAGCAGGACACAACTTTGGCAGTCACCGCAATCCGAGAAACTTTTGAAGAA
ACAGGACTTCTACTTGTTTCTTCTGACGAGCCCTCCACAACGGCGCCCCTCGACGACGCTCAATTGGAAGACGCG
CGTCATCGCATCCACCAGCAGAAGCTACTATGGCAGGAGTTCCTTGATTCTCGCCGTCTGAGATTAGATGTTAGT
GCACTCTTACCTTTTACGCAATGGATCACTCCCAAAGAAGCGCCACGGTAGGTATTCGGCTTTTCGCAAGCTTAT
TCATGTGATTTTCACTGGACTGTAACAGCCGGTTCCATACACAATTCTTTATCACATTCCTGCCTGCTACACCTT
CAACAGGTTTTAATTCTGGAGCAAAGCATGAACACATTCCCAAAACAGGTGAGCTTCCTTCCACTGATATACCAT
ATGAGAACCTAATAACAGCACACTCAACTTGGGGCTCAATGTAGATGGAGGCCAAGAGGTCATCTCCACGAGATT
CGTTCACCCTAGCGCGATTTTACGCGAGTTCCATGACGGCAAAATTACCCTCTTGCCACCTCAATTCTACCTCCT
TACAACACTTGTCGATGTACTTCAAGGAGTATCAAATACCGAGAAGCAAAGGATGCGAGTGGAGCACATATCTCG
AAGCAATTTTGGTCGCATGACATTTAATCCCCGTCCGCTCAAAACAGAGGGCGAGGATCGTGTCCAGGGCCAGTT
AATACTCACGTATGAAGGCGACGAAACTCGAGGAGGTTCGCCCGGACGCTTACATCGTGCAAATTTACGGATGGC
TAACGGGGTGAGTACTGAATGACTTTTGAATTGTTGAACTTGGACTCTAAGAGATGCTATTCTAGTTAATTAGAG
AGATCGTCCTTCAACGCAACTTTGATATCTATGACAATGTTGATTCGCATGCGCATAACTTTTCTCAATCTTCCA
AACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail