Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056150
Gene name
Locationscaffold_3:852260..853889
Strand-
Gene length (bp)1629
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6 7.5E-112 107 402
PF00734 CBM_1 Fungal cellulose binding domain 3.4E-14 25 52

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 1 438 0.0E+00
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 438 6.0E-170
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 19 438 5.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 1 438 0.0E+00
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 438 6.0E-170
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 19 438 5.0E-166
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 18 438 2.0E-165
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 1 438 5.0E-160
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 8 438 7.0E-160
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 19 436 3.0E-158
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 18 438 8.0E-153
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 24 438 7.0E-150
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 24 436 3.0E-147
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 86 438 4.0E-129
sp|B2AE04|CEL6C_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6C PE=1 SV=1 63 438 1.0E-112
sp|B2AC20|CEL6B_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6B PE=1 SV=1 90 438 5.0E-84
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 88 438 3.0E-79
sp|Q7SIG5|GUN6_HUMIN Endoglucanase-6B OS=Humicola insolens GN=cel6B PE=1 SV=1 88 438 2.0E-78
sp|P50401|GUXA_CELFA Exoglucanase A OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) GN=cbhA PE=1 SV=1 90 438 1.0E-57
sp|P26414|GUNA_THEBI Endoglucanase A OS=Thermobispora bispora GN=celA PE=3 SV=1 100 394 4.0E-19
sp|P26222|GUN2_THEFU Endoglucanase E-2 OS=Thermobifida fusca GN=celB PE=1 SV=2 100 394 8.0E-19
sp|P07984|GUNA_CELFI Endoglucanase A OS=Cellulomonas fimi GN=cenA PE=1 SV=1 102 435 3.0E-17
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 1 88 8.0E-17
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 17 88 1.0E-15
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 3 64 2.0E-15
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 1 83 7.0E-15
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 20 83 2.0E-13
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 5 75 7.0E-11
sp|P13933|GUN1_STRSS Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) GN=casA PE=1 SV=3 123 394 2.0E-10
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 24 97 1.0E-09
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 24 97 1.0E-09
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 10 79 3.0E-09
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 24 56 3.0E-09
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 25 56 4.0E-09
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 25 56 5.0E-09
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 12 57 9.0E-09
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 25 56 1.0E-08
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 25 56 1.0E-08
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 25 56 2.0E-08
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 8 100 3.0E-08
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 25 56 8.0E-08
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 25 56 9.0E-08
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 25 56 1.0E-07
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 24 56 1.0E-07
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 25 56 1.0E-07
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 25 56 1.0E-07
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 25 56 1.0E-07
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 25 56 1.0E-07
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 3 55 4.0E-07
sp|P33682|GUN1_STRHA Endoglucanase 1 OS=Streptomyces halstedii GN=celA1 PE=1 SV=2 154 394 4.0E-07
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 20 57 5.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 9 63 6.0E-07
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 25 56 8.0E-07
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 10 57 8.0E-07
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 25 56 1.0E-06
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 25 56 1.0E-06
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 25 55 1.0E-06
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 8 57 1.0E-06
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 8 57 1.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 25 56 2.0E-06
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 25 56 3.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 25 56 4.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 22 56 5.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 25 56 6.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 25 56 6.0E-06
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 25 56 8.0E-06
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 25 56 8.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 25 56 9.0E-06
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 25 56 9.0E-06
sp|Q8NK02|CBHB_EMENI 1,4-beta-D-glucan cellobiohydrolase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhB PE=3 SV=1 21 56 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030245 cellulose catabolic process Yes
GO:0030248 cellulose binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0005576 extracellular region Yes
GO:0044248 cellular catabolic process No
GO:0008152 metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0005976 polysaccharide metabolic process No
GO:0009056 catabolic process No
GO:0051273 beta-glucan metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0044042 glucan metabolic process No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0044264 cellular polysaccharide metabolic process No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0030243 cellulose metabolic process No
GO:0009251 glucan catabolic process No
GO:0051275 beta-glucan catabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0003674 molecular_function No
GO:0044247 cellular polysaccharide catabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 266.15 81.71 450.60
Initials Initials knots 20.48 11.04 29.92
Pileal_Stipeal_center Stage I stipe center 22.33 12.15 32.51
Pileal_Stipeal_shell Stage I stipe shell 17.14 8.87 25.42
DIF_stipe_center Stage II stipe center 29.80 16.80 42.80
DIF_stipe_shell Stage II stipe shell 23.82 12.88 34.77
DIF_stipe_skin Stage II stipe skin 16.29 8.46 24.12
DIF_cap_skin Stage II cap skin 13.35 6.62 20.08
DIF_cap_tissue Stage II cap tissue 16.08 8.34 23.82
DIF_gill_tissue Stage II gill tissue 22.90 12.53 33.27
YFB_stipe_center Young fruiting body stipe center 22.81 12.34 33.27
YFB_stipe_shell Young fruiting body stipe shell 28.00 15.45 40.55
YFB_stipe_skin Young fruiting body stipe skin 16.53 8.58 24.48
YFB_cap_skin Young fruiting body cap skin 12.93 6.54 19.31
YFB_cap_tissue Young fruiting body cap tissue 26.62 14.83 38.41
YFB_gill_tissue Young fruiting body gill tissue 17.24 9.00 25.47
YFB_veil Young fruiting body veil 21.17 11.41 30.93

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.993898 no
DIF_gill_tissue YFB_stipe_shell 0.647988 no
DIF_gill_tissue YFB_stipe_skin 0.388722 no
DIF_gill_tissue YFB_cap_skin 0.080708 no
DIF_gill_tissue YFB_cap_tissue 0.753040 no
DIF_gill_tissue YFB_gill_tissue 0.493720 no
DIF_gill_tissue YFB_veil 0.894478 no
YFB_stipe_center YFB_stipe_shell 0.637597 no
YFB_stipe_center YFB_stipe_skin 0.395511 no
YFB_stipe_center YFB_cap_skin 0.075908 no
YFB_stipe_center YFB_cap_tissue 0.744926 no
YFB_stipe_center YFB_gill_tissue 0.499237 no
YFB_stipe_center YFB_veil 0.897590 no
YFB_stipe_shell YFB_stipe_skin 0.098276 no
YFB_stipe_shell YFB_cap_skin 0.009446 yes
YFB_stipe_shell YFB_cap_tissue 0.931386 no
YFB_stipe_shell YFB_gill_tissue 0.153410 no
YFB_stipe_shell YFB_veil 0.483950 no
YFB_stipe_skin YFB_cap_skin 0.570335 no
YFB_stipe_skin YFB_cap_tissue 0.137318 no
YFB_stipe_skin YFB_gill_tissue 0.948000 no
YFB_stipe_skin YFB_veil 0.564035 no
YFB_cap_skin YFB_cap_tissue 0.017507 yes
YFB_cap_skin YFB_gill_tissue 0.494108 no
YFB_cap_skin YFB_veil 0.143621 no
YFB_cap_tissue YFB_gill_tissue 0.211586 no
YFB_cap_tissue YFB_veil 0.595881 no
YFB_gill_tissue YFB_veil 0.668396 no
Initials DIF_gill_tissue 0.832632 no
Initials YFB_stipe_center 0.840537 no
Initials YFB_stipe_shell 0.400834 no
Initials YFB_stipe_skin 0.625674 no
Initials YFB_cap_skin 0.182806 no
Initials YFB_cap_tissue 0.506633 no
Initials YFB_gill_tissue 0.723870 no
Initials YFB_veil 0.957164 no
Initials Pileal_Stipeal_center 0.876067 no
Initials Pileal_Stipeal_shell 0.702685 no
Initials DIF_stipe_center 0.272443 no
Initials DIF_stipe_shell 0.754482 no
Initials DIF_stipe_skin 0.596542 no
Initials DIF_cap_skin 0.233528 no
Initials DIF_cap_tissue 0.583135 no
Pileal_Stipeal_center DIF_gill_tissue 0.969251 no
Pileal_Stipeal_center YFB_stipe_center 0.973729 no
Pileal_Stipeal_center YFB_stipe_shell 0.595972 no
Pileal_Stipeal_center YFB_stipe_skin 0.446345 no
Pileal_Stipeal_center YFB_cap_skin 0.096785 no
Pileal_Stipeal_center YFB_cap_tissue 0.704018 no
Pileal_Stipeal_center YFB_gill_tissue 0.549091 no
Pileal_Stipeal_center YFB_veil 0.931606 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.520373 no
Pileal_Stipeal_center DIF_stipe_center 0.450181 no
Pileal_Stipeal_center DIF_stipe_shell 0.913996 no
Pileal_Stipeal_center DIF_stipe_skin 0.420349 no
Pileal_Stipeal_center DIF_cap_skin 0.128525 no
Pileal_Stipeal_center DIF_cap_tissue 0.408273 no
Pileal_Stipeal_shell DIF_gill_tissue 0.458243 no
Pileal_Stipeal_shell YFB_stipe_center 0.466928 no
Pileal_Stipeal_shell YFB_stipe_shell 0.129100 no
Pileal_Stipeal_shell YFB_stipe_skin 0.956200 no
Pileal_Stipeal_shell YFB_cap_skin 0.495702 no
Pileal_Stipeal_shell YFB_cap_tissue 0.179947 no
Pileal_Stipeal_shell YFB_gill_tissue 0.993037 no
Pileal_Stipeal_shell YFB_veil 0.646259 no
Pileal_Stipeal_shell DIF_stipe_center 0.067706 no
Pileal_Stipeal_shell DIF_stipe_shell 0.379125 no
Pileal_Stipeal_shell DIF_stipe_skin 0.935499 no
Pileal_Stipeal_shell DIF_cap_skin 0.572432 no
Pileal_Stipeal_shell DIF_cap_tissue 0.919925 no
DIF_stipe_center DIF_gill_tissue 0.495245 no
DIF_stipe_center YFB_stipe_center 0.487851 no
DIF_stipe_center YFB_stipe_shell 0.914632 no
DIF_stipe_center YFB_stipe_skin 0.053565 no
DIF_stipe_center YFB_cap_skin 0.003365 yes
DIF_stipe_center YFB_cap_tissue 0.827234 no
DIF_stipe_center YFB_gill_tissue 0.088095 no
DIF_stipe_center YFB_veil 0.345375 no
DIF_stipe_center DIF_stipe_shell 0.591156 no
DIF_stipe_center DIF_stipe_skin 0.045701 yes
DIF_stipe_center DIF_cap_skin 0.010093 yes
DIF_stipe_center DIF_cap_tissue 0.049882 yes
DIF_stipe_shell DIF_gill_tissue 0.949106 no
DIF_stipe_shell YFB_stipe_center 0.942303 no
DIF_stipe_shell YFB_stipe_shell 0.734195 no
DIF_stipe_shell YFB_stipe_skin 0.313067 no
DIF_stipe_shell YFB_cap_skin 0.055979 no
DIF_stipe_shell YFB_cap_tissue 0.832420 no
DIF_stipe_shell YFB_gill_tissue 0.410474 no
DIF_stipe_shell YFB_veil 0.827262 no
DIF_stipe_shell DIF_stipe_skin 0.290559 no
DIF_stipe_shell DIF_cap_skin 0.082633 no
DIF_stipe_shell DIF_cap_tissue 0.288589 no
DIF_stipe_skin DIF_gill_tissue 0.356290 no
DIF_stipe_skin YFB_stipe_center 0.363051 no
DIF_stipe_skin YFB_stipe_shell 0.086585 no
DIF_stipe_skin YFB_stipe_skin 0.983119 no
DIF_stipe_skin YFB_cap_skin 0.604439 no
DIF_stipe_skin YFB_cap_tissue 0.126023 no
DIF_stipe_skin YFB_gill_tissue 0.930256 no
DIF_stipe_skin YFB_veil 0.530650 no
DIF_stipe_skin DIF_cap_skin 0.679315 no
DIF_stipe_skin DIF_cap_tissue 0.985052 no
DIF_cap_skin DIF_gill_tissue 0.113966 no
DIF_cap_skin YFB_stipe_center 0.112721 no
DIF_cap_skin YFB_stipe_shell 0.018624 yes
DIF_cap_skin YFB_stipe_skin 0.653646 no
DIF_cap_skin YFB_cap_skin 0.961525 no
DIF_cap_skin YFB_cap_tissue 0.028918 yes
DIF_cap_skin YFB_gill_tissue 0.579844 no
DIF_cap_skin YFB_veil 0.196757 no
DIF_cap_skin DIF_cap_tissue 0.720499 no
DIF_cap_tissue DIF_gill_tissue 0.353104 no
DIF_cap_tissue YFB_stipe_center 0.359174 no
DIF_cap_tissue YFB_stipe_shell 0.086416 no
DIF_cap_tissue YFB_stipe_skin 0.967953 no
DIF_cap_tissue YFB_cap_skin 0.641435 no
DIF_cap_tissue YFB_cap_tissue 0.127784 no
DIF_cap_tissue YFB_gill_tissue 0.913413 no
DIF_cap_tissue YFB_veil 0.520840 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056150
MFKFAALLALASLVPGFVQAQSPVWGQCGGNGWTGPTTCASGSTCVKQNDFYSQCLPNNQAPPSTTTQPGTTPPA
TTTSGGTGPTSGAGNPYTGKTVWLSPFYADEVAQAAADISNPSLATKAASVAKIPTFVWFDTVAKVPDLGGYLAD
ARSKNQLVQIVVYDLPDRDCAALASNGEFSLANDGLNKYKNYVDQIAAQIKQFPDVSVVAVIEPDSLANLVTNLN
VQKCANAQSAYKEGVIYAVQKLNAVGVTMYIDAGHAGWLGWPANLSPAAQLFAQIYRDAGSPRNLRGIATNVANF
NALRASSPDPITQGNSNYDEIHYIEALAPMLSNAGFPAHFIVDQGRSGVQNIRDQWGDWCNVKGAGFGQRPTTNT
GSSLIDAIVWVKPGGECDGTSDNSSPRFDSHCSLSDAHQPAPEAGTWFQAYFETLVANANPAL*
Coding >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGACTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGAT
TTCTATTCTCAGTGCCTTCCCAACAATCAAGCTCCTCCTTCCACAACTACACAGCCTGGCACCACACCCCCCGCC
ACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCCTTATACCGGTAAAACGGTCTGGCTGTCA
CCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCTTCG
GTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCCGAT
GCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCCTCT
AACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAGATT
AAGCAGTTCCCTGACGTATCCGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAAC
GTCCAAAAATGTGCTAACGCCCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTT
GGTGTTACCATGTACATCGATGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAA
CTCTTTGCCCAAATCTACAGAGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTC
AACGCCCTTAGAGCTTCCTCTCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAA
GCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTCACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAG
AATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGGGTGCTGGCTTCGGTCAACGACCGACAACAAATACT
GGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAGGTGGCGAATGCGACGGTACCTCAGACAATTCATCC
CCTCGGTTCGACTCGCATTGCTCTCTTAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACCTGGTTCCAAGCT
TACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA
Transcript >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGACTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGAT
TTCTATTCTCAGTGCCTTCCCAACAATCAAGCTCCTCCTTCCACAACTACACAGCCTGGCACCACACCCCCCGCC
ACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCCTTATACCGGTAAAACGGTCTGGCTGTCA
CCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCTTCG
GTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCCGAT
GCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCCTCT
AACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAGATT
AAGCAGTTCCCTGACGTATCCGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAAC
GTCCAAAAATGTGCTAACGCCCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTT
GGTGTTACCATGTACATCGATGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAA
CTCTTTGCCCAAATCTACAGAGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTC
AACGCCCTTAGAGCTTCCTCTCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAA
GCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTCACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAG
AATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGGGTGCTGGCTTCGGTCAACGACCGACAACAAATACT
GGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAGGTGGCGAATGCGACGGTACCTCAGACAATTCATCC
CCTCGGTTCGACTCGCATTGCTCTCTTAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACCTGGTTCCAAGCT
TACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA
Gene >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGAGTAAGTGGTGACACAGGAAGGGAATTTATCTCACCTGTGTTTCATATGAT
AGCTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGATTTCTATTCTCAGTGCCTGTACGT
ATATACTTTATGTCGAAGCAACCACAGAGATCAAACAAAACGTAGTCCCAACAATCAAGCTCCTCCTTCCACAAC
TACACAGCCTGGCACCACACCCCCCGCCACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCC
TTATACCGGTAAAACGGTACGTGATTACTTGTCACCTCTTTGCCAACATTTTCATCTTTCTAACAGGTCTGGCTG
TCACCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCT
TCGGTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCC
GATGCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCC
TCTAACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAG
ATTAAGCGTACGGTTTCTGCATTCCGTCATGTTTCCGAACGCTAACTTGGAATTTTCAGAGTTCCCTGACGTATC
CGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAACGTCCAAAAATGTGCTAACGC
CCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTTGGTGTTACCATGTACATCGA
TGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAACTCTTTGCCCAAATCTACAG
AGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTCAACGCCCTTAGAGCTTCCTC
TCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAAGTCAGTTGCGGCATTTGCTA
TGATCACTGTTGTTGGGTGCTAATATCAATTACAGGCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTC
ACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAGAATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGG
GTGCTGGCTTCGGTCAACGACCGACAACAAATACTGGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAG
GTGGCGAATGCGACGGTACCTCAGACAATTCATCCCCTCGGTTCGACTCGCATTGCTCTCTTAGGTGAGTATATC
ACCTTCAATTTTTTGGGTCTATTGCTAACGAAACTTCGCAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACC
TGGTTCCAAGCTTACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail