Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056150
Gene name
Locationscaffold_3:852260..853889
Strand-
Gene length (bp)1629
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6 7.5E-112 107 402
PF00734 CBM_1 Fungal cellulose binding domain 3.4E-14 25 52

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 1 438 0.0E+00
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 438 6.0E-170
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 19 438 5.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 1 438 0.0E+00
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 438 6.0E-170
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 438 4.0E-169
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 19 438 5.0E-166
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 18 438 2.0E-165
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 1 438 5.0E-160
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 8 438 7.0E-160
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 19 436 3.0E-158
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 18 438 8.0E-153
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 24 438 7.0E-150
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 24 436 3.0E-147
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 86 438 4.0E-129
sp|B2AE04|CEL6C_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6C PE=1 SV=1 63 438 1.0E-112
sp|B2AC20|CEL6B_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6B PE=1 SV=1 90 438 5.0E-84
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 88 438 3.0E-79
sp|Q7SIG5|GUN6_HUMIN Endoglucanase-6B OS=Humicola insolens GN=cel6B PE=1 SV=1 88 438 2.0E-78
sp|P50401|GUXA_CELFA Exoglucanase A OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) GN=cbhA PE=1 SV=1 90 438 1.0E-57
sp|P26414|GUNA_THEBI Endoglucanase A OS=Thermobispora bispora GN=celA PE=3 SV=1 100 394 4.0E-19
sp|P26222|GUN2_THEFU Endoglucanase E-2 OS=Thermobifida fusca GN=celB PE=1 SV=2 100 394 8.0E-19
sp|P07984|GUNA_CELFI Endoglucanase A OS=Cellulomonas fimi GN=cenA PE=1 SV=1 102 435 3.0E-17
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 1 88 8.0E-17
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 17 88 1.0E-15
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 3 64 2.0E-15
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 1 83 7.0E-15
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 20 83 2.0E-13
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 5 75 7.0E-11
sp|P13933|GUN1_STRSS Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) GN=casA PE=1 SV=3 123 394 2.0E-10
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 24 97 1.0E-09
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 24 97 1.0E-09
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 10 79 3.0E-09
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 24 56 3.0E-09
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 25 56 4.0E-09
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 25 56 5.0E-09
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 12 57 9.0E-09
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 25 56 1.0E-08
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 25 56 1.0E-08
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 25 56 2.0E-08
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 8 100 3.0E-08
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 25 56 8.0E-08
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 25 56 9.0E-08
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 25 56 1.0E-07
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 24 56 1.0E-07
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 25 56 1.0E-07
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 25 56 1.0E-07
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 25 56 1.0E-07
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 25 56 1.0E-07
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 3 55 4.0E-07
sp|P33682|GUN1_STRHA Endoglucanase 1 OS=Streptomyces halstedii GN=celA1 PE=1 SV=2 154 394 4.0E-07
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 20 57 5.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 9 63 6.0E-07
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 25 56 8.0E-07
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 10 57 8.0E-07
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 25 56 1.0E-06
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 25 56 1.0E-06
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 25 55 1.0E-06
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 8 57 1.0E-06
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 8 57 1.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 25 56 2.0E-06
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 25 56 3.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 25 56 4.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 22 56 5.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 25 56 6.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 25 56 6.0E-06
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 25 56 8.0E-06
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 25 56 8.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 25 56 9.0E-06
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 25 56 9.0E-06
sp|Q8NK02|CBHB_EMENI 1,4-beta-D-glucan cellobiohydrolase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhB PE=3 SV=1 21 56 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030245 cellulose catabolic process Yes
GO:0030248 cellulose binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0005576 extracellular region Yes
GO:0044248 cellular catabolic process No
GO:0008152 metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0005976 polysaccharide metabolic process No
GO:0009056 catabolic process No
GO:0051273 beta-glucan metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0044042 glucan metabolic process No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0044264 cellular polysaccharide metabolic process No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0030243 cellulose metabolic process No
GO:0009251 glucan catabolic process No
GO:0051275 beta-glucan catabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0003674 molecular_function No
GO:0044247 cellular polysaccharide catabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056150
MFKFAALLALASLVPGFVQAQSPVWGQCGGNGWTGPTTCASGSTCVKQNDFYSQCLPNNQAPPSTTTQPGTTPPA
TTTSGGTGPTSGAGNPYTGKTVWLSPFYADEVAQAAADISNPSLATKAASVAKIPTFVWFDTVAKVPDLGGYLAD
ARSKNQLVQIVVYDLPDRDCAALASNGEFSLANDGLNKYKNYVDQIAAQIKQFPDVSVVAVIEPDSLANLVTNLN
VQKCANAQSAYKEGVIYAVQKLNAVGVTMYIDAGHAGWLGWPANLSPAAQLFAQIYRDAGSPRNLRGIATNVANF
NALRASSPDPITQGNSNYDEIHYIEALAPMLSNAGFPAHFIVDQGRSGVQNIRDQWGDWCNVKGAGFGQRPTTNT
GSSLIDAIVWVKPGGECDGTSDNSSPRFDSHCSLSDAHQPAPEAGTWFQAYFETLVANANPAL*
Coding >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGACTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGAT
TTCTATTCTCAGTGCCTTCCCAACAATCAAGCTCCTCCTTCCACAACTACACAGCCTGGCACCACACCCCCCGCC
ACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCCTTATACCGGTAAAACGGTCTGGCTGTCA
CCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCTTCG
GTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCCGAT
GCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCCTCT
AACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAGATT
AAGCAGTTCCCTGACGTATCCGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAAC
GTCCAAAAATGTGCTAACGCCCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTT
GGTGTTACCATGTACATCGATGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAA
CTCTTTGCCCAAATCTACAGAGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTC
AACGCCCTTAGAGCTTCCTCTCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAA
GCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTCACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAG
AATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGGGTGCTGGCTTCGGTCAACGACCGACAACAAATACT
GGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAGGTGGCGAATGCGACGGTACCTCAGACAATTCATCC
CCTCGGTTCGACTCGCATTGCTCTCTTAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACCTGGTTCCAAGCT
TACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA
Transcript >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGACTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGAT
TTCTATTCTCAGTGCCTTCCCAACAATCAAGCTCCTCCTTCCACAACTACACAGCCTGGCACCACACCCCCCGCC
ACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCCTTATACCGGTAAAACGGTCTGGCTGTCA
CCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCTTCG
GTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCCGAT
GCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCCTCT
AACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAGATT
AAGCAGTTCCCTGACGTATCCGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAAC
GTCCAAAAATGTGCTAACGCCCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTT
GGTGTTACCATGTACATCGATGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAA
CTCTTTGCCCAAATCTACAGAGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTC
AACGCCCTTAGAGCTTCCTCTCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAA
GCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTCACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAG
AATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGGGTGCTGGCTTCGGTCAACGACCGACAACAAATACT
GGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAGGTGGCGAATGCGACGGTACCTCAGACAATTCATCC
CCTCGGTTCGACTCGCATTGCTCTCTTAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACCTGGTTCCAAGCT
TACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA
Gene >AgabiH97|056150
ATGTTCAAATTCGCTGCTCTACTAGCTTTGGCTTCGCTCGTCCCAGGCTTTGTCCAGGCTCAGTCACCTGTATGG
GGTCAATGCGGTGGTAATGGCTGGAGTAAGTGGTGACACAGGAAGGGAATTTATCTCACCTGTGTTTCATATGAT
AGCTGGCCCGACAACCTGCGCTTCGGGCTCAACCTGCGTGAAGCAGAATGATTTCTATTCTCAGTGCCTGTACGT
ATATACTTTATGTCGAAGCAACCACAGAGATCAAACAAAACGTAGTCCCAACAATCAAGCTCCTCCTTCCACAAC
TACACAGCCTGGCACCACACCCCCCGCCACCACCACTTCCGGCGGCACAGGGCCTACTTCAGGTGCTGGAAACCC
TTATACCGGTAAAACGGTACGTGATTACTTGTCACCTCTTTGCCAACATTTTCATCTTTCTAACAGGTCTGGCTG
TCACCGTTCTATGCCGACGAGGTCGCGCAAGCGGCCGCTGATATATCCAATCCTAGTTTGGCAACCAAGGCTGCT
TCGGTTGCTAAAATCCCTACCTTCGTTTGGTTTGATACGGTTGCCAAGGTTCCCGACCTCGGTGGCTACCTTGCC
GATGCCCGGTCCAAGAACCAGCTCGTTCAAATTGTTGTCTACGATCTGCCCGACCGTGACTGCGCCGCCCTCGCC
TCTAACGGAGAGTTCTCTCTCGCCAATGATGGCCTCAACAAGTATAAGAACTATGTTGACCAGATTGCGGCCCAG
ATTAAGCGTACGGTTTCTGCATTCCGTCATGTTTCCGAACGCTAACTTGGAATTTTCAGAGTTCCCTGACGTATC
CGTCGTGGCTGTCATTGAGCCTGACTCGCTCGCTAATTTGGTCACAAATTTGAACGTCCAAAAATGTGCTAACGC
CCAAAGCGCTTACAAGGAGGGTGTCATTTACGCTGTCCAAAAACTTAACGCAGTTGGTGTTACCATGTACATCGA
TGCTGGCCATGCTGGATGGTTGGGCTGGCCTGCTAATCTGTCCCCTGCCGCCCAACTCTTTGCCCAAATCTACAG
AGACGCTGGCTCGCCCAGAAACCTTCGTGGTATCGCCACGAACGTTGCCAACTTCAACGCCCTTAGAGCTTCCTC
TCCCGATCCTATCACTCAGGGCAACAGTAATTATGACGAAATACACTACATTGAAGTCAGTTGCGGCATTTGCTA
TGATCACTGTTGTTGGGTGCTAATATCAATTACAGGCTCTTGCTCCCATGCTCAGTAATGCTGGTTTCCCTGCTC
ACTTCATCGTCGACCAAGGTCGCTCGGGTGTTCAGAATATCAGAGACCAGTGGGGCGACTGGTGCAACGTCAAGG
GTGCTGGCTTCGGTCAACGACCGACAACAAATACTGGCTCCTCGCTCATCGATGCTATTGTCTGGGTCAAGCCAG
GTGGCGAATGCGACGGTACCTCAGACAATTCATCCCCTCGGTTCGACTCGCATTGCTCTCTTAGGTGAGTATATC
ACCTTCAATTTTTTGGGTCTATTGCTAACGAAACTTCGCAGCGACGCTCATCAACCCGCTCCTGAGGCTGGTACC
TGGTTCCAAGCTTACTTTGAGACCTTGGTTGCGAATGCCAACCCTGCCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail