Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056140
Gene name
Locationscaffold_3:849870..851861
Strand-
Gene length (bp)1991
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 3.0E-95 80 441
PF01212 Beta_elim_lyase Beta-eliminating lyase 5.9E-08 121 280
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 1.7E-04 131 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y697|NFS1_HUMAN Cysteine desulfurase, mitochondrial OS=Homo sapiens GN=NFS1 PE=1 SV=3 78 478 0.0E+00
sp|Q5RDE7|NFS1_PONAB Cysteine desulfurase, mitochondrial OS=Pongo abelii GN=NFS1 PE=2 SV=1 78 478 0.0E+00
sp|Q99P39|NFS1_RAT Cysteine desulfurase, mitochondrial OS=Rattus norvegicus GN=Nfs1 PE=2 SV=1 66 478 0.0E+00
sp|Q9Z1J3|NFS1_MOUSE Cysteine desulfurase, mitochondrial OS=Mus musculus GN=Nfs1 PE=1 SV=3 78 478 0.0E+00
sp|P0DN31|NFS1_ARTBC Cysteine desulfurase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-2 PE=3 SV=1 4 478 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y697|NFS1_HUMAN Cysteine desulfurase, mitochondrial OS=Homo sapiens GN=NFS1 PE=1 SV=3 78 478 0.0E+00
sp|Q5RDE7|NFS1_PONAB Cysteine desulfurase, mitochondrial OS=Pongo abelii GN=NFS1 PE=2 SV=1 78 478 0.0E+00
sp|Q99P39|NFS1_RAT Cysteine desulfurase, mitochondrial OS=Rattus norvegicus GN=Nfs1 PE=2 SV=1 66 478 0.0E+00
sp|Q9Z1J3|NFS1_MOUSE Cysteine desulfurase, mitochondrial OS=Mus musculus GN=Nfs1 PE=1 SV=3 78 478 0.0E+00
sp|P0DN31|NFS1_ARTBC Cysteine desulfurase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-2 PE=3 SV=1 4 478 0.0E+00
sp|Q9VKD3|NFS1_DROME Probable cysteine desulfurase, mitochondrial OS=Drosophila melanogaster GN=CG12264 PE=2 SV=1 78 478 0.0E+00
sp|O60028|NFS1_ASHGO Cysteine desulfurase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NFS1 PE=3 SV=1 70 478 0.0E+00
sp|Q54X04|NFS1_DICDI Probable cysteine desulfurase, mitochondrial OS=Dictyostelium discoideum GN=nfs1 PE=1 SV=1 66 477 0.0E+00
sp|P87185|NFS1_CANAL Cysteine desulfurase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NFS1 PE=2 SV=1 64 478 0.0E+00
sp|P25374|NFS1_YEAST Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFS1 PE=1 SV=2 77 478 0.0E+00
sp|P87187|NFS1_CANMA Cysteine desulfurase, mitochondrial OS=Candida maltosa GN=SPL1 PE=3 SV=1 64 478 0.0E+00
sp|O74351|NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21D10.11c PE=3 SV=2 38 478 0.0E+00
sp|A8F204|ISCS_RICM5 Cysteine desulfurase IscS OS=Rickettsia massiliae (strain Mtu5) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|Q4UL77|ISCS_RICFE Cysteine desulfurase IscS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=iscS PE=3 SV=2 79 478 0.0E+00
sp|C3PNQ8|ISCS_RICAE Cysteine desulfurase IscS OS=Rickettsia africae (strain ESF-5) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|Q92HP1|ISCS_RICCN Cysteine desulfurase IscS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|O49543|MNIF1_ARATH Cysteine desulfurase, mitochondrial OS=Arabidopsis thaliana GN=NIFS1 PE=1 SV=1 18 478 0.0E+00
sp|A8GSG4|ISCS_RICRS Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Sheila Smith) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|B0BXX6|ISCS_RICRO Cysteine desulfurase IscS OS=Rickettsia rickettsii (strain Iowa) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|C4K1Z7|ISCS_RICPU Cysteine desulfurase IscS OS=Rickettsia peacockii (strain Rustic) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|A8EYH9|ISCS_RICCK Cysteine desulfurase IscS OS=Rickettsia canadensis (strain McKiel) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|A8GWB2|ISCS_RICB8 Cysteine desulfurase IscS OS=Rickettsia bellii (strain OSU 85-389) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|A8GNU0|ISCS_RICAH Cysteine desulfurase IscS OS=Rickettsia akari (strain Hartford) GN=iscS PE=3 SV=1 77 478 0.0E+00
sp|Q9ZD60|ISCS_RICPR Cysteine desulfurase IscS OS=Rickettsia prowazekii (strain Madrid E) GN=iscS PE=3 SV=1 73 478 0.0E+00
sp|Q1RHY6|ISCS_RICBR Cysteine desulfurase IscS OS=Rickettsia bellii (strain RML369-C) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|Q68WP6|ISCS_RICTY Cysteine desulfurase IscS OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=iscS PE=3 SV=1 73 478 0.0E+00
sp|Q2GGJ4|ISCS_EHRCR Cysteine desulfurase IscS OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|C6DBJ1|ISCS_PECCP Cysteine desulfurase IscS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|A6TCF1|ISCS_KLEP7 Cysteine desulfurase IscS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|Q6D259|ISCS_PECAS Cysteine desulfurase IscS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=iscS PE=3 SV=1 79 478 0.0E+00
sp|Q8EEU9|ISCS_SHEON Cysteine desulfurase IscS OS=Shewanella oneidensis (strain MR-1) GN=iscS PE=3 SV=1 79 478 1.0E-180
sp|B5XNJ7|ISCS_KLEP3 Cysteine desulfurase IscS OS=Klebsiella pneumoniae (strain 342) GN=iscS PE=3 SV=1 79 478 2.0E-180
sp|P0A6C0|ISCS_SHIFL Cysteine desulfurase IscS OS=Shigella flexneri GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|Q0T1Y9|ISCS_SHIF8 Cysteine desulfurase IscS OS=Shigella flexneri serotype 5b (strain 8401) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B2TXV5|ISCS_SHIB3 Cysteine desulfurase IscS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B1LNI6|ISCS_ECOSM Cysteine desulfurase IscS OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B6I5A2|ISCS_ECOSE Cysteine desulfurase IscS OS=Escherichia coli (strain SE11) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7N6B7|ISCS_ECOLU Cysteine desulfurase IscS OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|P0A6B7|ISCS_ECOLI Cysteine desulfurase IscS OS=Escherichia coli (strain K12) GN=iscS PE=1 SV=1 79 478 4.0E-180
sp|B1IWD1|ISCS_ECOLC Cysteine desulfurase IscS OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|P0A6B8|ISCS_ECOL6 Cysteine desulfurase IscS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|Q0TEV5|ISCS_ECOL5 Cysteine desulfurase IscS OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|A8A336|ISCS_ECOHS Cysteine desulfurase IscS OS=Escherichia coli O9:H4 (strain HS) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B1XB05|ISCS_ECODH Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / DH10B) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|C4ZXA5|ISCS_ECOBW Cysteine desulfurase IscS OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7M7N3|ISCS_ECO8A Cysteine desulfurase IscS OS=Escherichia coli O8 (strain IAI1) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7MYG3|ISCS_ECO81 Cysteine desulfurase IscS OS=Escherichia coli O81 (strain ED1a) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7NRH9|ISCS_ECO7I Cysteine desulfurase IscS OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B5Z104|ISCS_ECO5E Cysteine desulfurase IscS OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|P0A6B9|ISCS_ECO57 Cysteine desulfurase IscS OS=Escherichia coli O157:H7 GN=iscS PE=1 SV=1 79 478 4.0E-180
sp|B7LDC2|ISCS_ECO55 Cysteine desulfurase IscS OS=Escherichia coli (strain 55989 / EAEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7MIM0|ISCS_ECO45 Cysteine desulfurase IscS OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7UGX6|ISCS_ECO27 Cysteine desulfurase IscS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|A7ZPX4|ISCS_ECO24 Cysteine desulfurase IscS OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iscS PE=3 SV=1 79 478 4.0E-180
sp|B7LKA9|ISCS_ESCF3 Cysteine desulfurase IscS OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=iscS PE=3 SV=1 79 478 2.0E-179
sp|A8GHY3|ISCS_SERP5 Cysteine desulfurase IscS OS=Serratia proteamaculans (strain 568) GN=iscS PE=3 SV=1 79 478 4.0E-179
sp|Q8SQS2|NFS1_ENCCU Cysteine desulfurase, mitosomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=NFS1 PE=3 SV=1 80 476 4.0E-179
sp|B4TRX5|ISCS_SALSV Cysteine desulfurase IscS OS=Salmonella schwarzengrund (strain CVM19633) GN=iscS PE=3 SV=1 79 478 6.0E-179
sp|Q8ZN40|ISCS_SALTY Cysteine desulfurase IscS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B5BAW6|ISCS_SALPK Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain AKU_12601) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|A9N1X5|ISCS_SALPB Cysteine desulfurase IscS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|Q5PNG1|ISCS_SALPA Cysteine desulfurase IscS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B4T0S2|ISCS_SALNS Cysteine desulfurase IscS OS=Salmonella newport (strain SL254) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B4TDB6|ISCS_SALHS Cysteine desulfurase IscS OS=Salmonella heidelberg (strain SL476) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B5RD12|ISCS_SALG2 Cysteine desulfurase IscS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B5R5A2|ISCS_SALEP Cysteine desulfurase IscS OS=Salmonella enteritidis PT4 (strain P125109) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B5FR85|ISCS_SALDC Cysteine desulfurase IscS OS=Salmonella dublin (strain CT_02021853) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|Q57LG9|ISCS_SALCH Cysteine desulfurase IscS OS=Salmonella choleraesuis (strain SC-B67) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|B5F1C0|ISCS_SALA4 Cysteine desulfurase IscS OS=Salmonella agona (strain SL483) GN=iscS PE=3 SV=1 79 478 7.0E-179
sp|Q8Z4N0|ISCS_SALTI Cysteine desulfurase IscS OS=Salmonella typhi GN=iscS PE=3 SV=1 79 478 2.0E-178
sp|A7MGX8|ISCS_CROS8 Cysteine desulfurase IscS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=iscS PE=3 SV=1 79 478 2.0E-178
sp|A4WDB1|ISCS_ENT38 Cysteine desulfurase IscS OS=Enterobacter sp. (strain 638) GN=iscS PE=3 SV=1 79 478 2.0E-178
sp|B8F356|ISCS_HAEPS Cysteine desulfurase IscS OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=iscS PE=3 SV=1 79 478 2.0E-178
sp|A9MHJ4|ISCS_SALAR Cysteine desulfurase IscS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=iscS PE=3 SV=1 79 478 7.0E-178
sp|C0PYK7|ISCS_SALPC Cysteine desulfurase IscS OS=Salmonella paratyphi C (strain RKS4594) GN=iscS PE=3 SV=1 79 478 8.0E-178
sp|B0YLW6|NFS1_TRAHO Cysteine desulfurase, mitosomal OS=Trachipleistophora hominis GN=NFS1 PE=1 SV=1 80 476 7.0E-176
sp|Q3IFI3|ISCS_PSEHT Cysteine desulfurase IscS OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=iscS PE=3 SV=1 79 478 2.0E-174
sp|A1RJ52|ISCS_SHESW Cysteine desulfurase IscS OS=Shewanella sp. (strain W3-18-1) GN=iscS PE=3 SV=1 79 478 4.0E-173
sp|A4Y7D7|ISCS_SHEPC Cysteine desulfurase IscS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=iscS PE=3 SV=1 79 478 4.0E-173
sp|Q7N224|ISCS_PHOLL Cysteine desulfurase IscS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=iscS PE=3 SV=1 79 478 4.0E-173
sp|Q080P6|ISCS_SHEFN Cysteine desulfurase IscS OS=Shewanella frigidimarina (strain NCIMB 400) GN=iscS PE=3 SV=1 79 478 5.0E-173
sp|A1S544|ISCS_SHEAM Cysteine desulfurase IscS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=iscS PE=3 SV=1 79 478 6.0E-173
sp|Q0HVP4|ISCS_SHESR Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-7) GN=iscS PE=3 SV=1 79 478 7.0E-173
sp|A0KXJ0|ISCS_SHESA Cysteine desulfurase IscS OS=Shewanella sp. (strain ANA-3) GN=iscS PE=3 SV=1 79 478 7.0E-173
sp|A3QFD5|ISCS_SHELP Cysteine desulfurase IscS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=iscS PE=3 SV=1 79 478 7.0E-173
sp|A8FXA5|ISCS_SHESH Cysteine desulfurase IscS OS=Shewanella sediminis (strain HAW-EB3) GN=iscS PE=3 SV=1 79 478 7.0E-173
sp|A6VMN7|ISCS_ACTSZ Cysteine desulfurase IscS OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=iscS PE=3 SV=1 79 478 1.0E-172
sp|P57803|ISCS_PASMU Cysteine desulfurase IscS OS=Pasteurella multocida (strain Pm70) GN=iscS PE=3 SV=1 79 478 1.0E-172
sp|A9M029|ISCS_NEIM0 Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup C (strain 053442) GN=iscS PE=3 SV=1 79 478 3.0E-172
sp|Q0HJF4|ISCS_SHESM Cysteine desulfurase IscS OS=Shewanella sp. (strain MR-4) GN=iscS PE=3 SV=1 79 478 3.0E-172
sp|Q486Z0|ISCS_COLP3 Cysteine desulfurase IscS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=iscS PE=3 SV=1 79 478 6.0E-172
sp|Q9KTY2|ISCS_VIBCH Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=iscS PE=3 SV=1 79 478 7.0E-172
sp|A5F3G4|ISCS_VIBC3 Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=iscS PE=3 SV=1 79 478 7.0E-172
sp|A7MU48|ISCS_VIBCB Cysteine desulfurase IscS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=iscS PE=3 SV=1 79 478 8.0E-172
sp|C3LT01|ISCS_VIBCM Cysteine desulfurase IscS OS=Vibrio cholerae serotype O1 (strain M66-2) GN=iscS PE=3 SV=1 79 478 1.0E-171
sp|C4L7K2|ISCS_TOLAT Cysteine desulfurase IscS OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=iscS PE=3 SV=1 79 478 1.0E-171
sp|B1KNI3|ISCS_SHEWM Cysteine desulfurase IscS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=iscS PE=3 SV=1 79 478 2.0E-171
sp|A1KUK1|ISCS_NEIMF Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=iscS PE=3 SV=1 79 478 2.0E-171
sp|Q12P83|ISCS_SHEDO Cysteine desulfurase IscS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=iscS PE=3 SV=1 79 478 2.0E-171
sp|Q87S28|ISCS_VIBPA Cysteine desulfurase IscS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=iscS PE=3 SV=1 79 478 2.0E-171
sp|B4EZU8|ISCS_PROMH Cysteine desulfurase IscS OS=Proteus mirabilis (strain HI4320) GN=iscS PE=3 SV=1 79 478 4.0E-171
sp|Q47EN5|ISCS_DECAR Cysteine desulfurase IscS OS=Dechloromonas aromatica (strain RCB) GN=iscS PE=3 SV=1 79 478 5.0E-171
sp|B4RMB8|ISCS_NEIG2 Cysteine desulfurase IscS OS=Neisseria gonorrhoeae (strain NCCP11945) GN=iscS PE=3 SV=1 79 478 6.0E-171
sp|Q5F8X4|ISCS_NEIG1 Cysteine desulfurase IscS OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=iscS PE=3 SV=1 79 478 6.0E-171
sp|Q9JTX0|ISCS_NEIMA Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=iscS PE=3 SV=1 79 478 1.0E-170
sp|Q7MNG2|ISCS_VIBVY Cysteine desulfurase IscS OS=Vibrio vulnificus (strain YJ016) GN=iscS PE=3 SV=1 79 478 1.0E-170
sp|Q8DEY7|ISCS_VIBVU Cysteine desulfurase IscS OS=Vibrio vulnificus (strain CMCP6) GN=iscS PE=3 SV=1 79 478 1.0E-170
sp|Q65RS7|ISCS_MANSM Cysteine desulfurase IscS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=iscS PE=3 SV=1 79 478 2.0E-170
sp|B8E9D2|ISCS_SHEB2 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS223) GN=iscS PE=3 SV=1 79 478 3.0E-170
sp|Q1H361|ISCS_METFK Cysteine desulfurase IscS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=iscS PE=3 SV=1 79 478 3.0E-170
sp|Q9JYY0|ISCS_NEIMB Cysteine desulfurase IscS OS=Neisseria meningitidis serogroup B (strain MC58) GN=iscS PE=3 SV=1 79 478 4.0E-170
sp|A9L3R0|ISCS_SHEB9 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS195) GN=iscS PE=3 SV=1 79 478 5.0E-170
sp|A6WNY5|ISCS_SHEB8 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS185) GN=iscS PE=3 SV=1 79 478 5.0E-170
sp|Q57337|ISCS_HAEIN Cysteine desulfurase IscS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscS PE=3 SV=2 79 478 6.0E-170
sp|A5UGI1|ISCS_HAEIG Cysteine desulfurase IscS OS=Haemophilus influenzae (strain PittGG) GN=iscS PE=3 SV=1 79 478 6.0E-170
sp|A1SUI4|ISCS_PSYIN Cysteine desulfurase IscS OS=Psychromonas ingrahamii (strain 37) GN=iscS PE=3 SV=1 79 477 6.0E-170
sp|A8H2M6|ISCS_SHEPA Cysteine desulfurase IscS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=iscS PE=3 SV=1 79 478 8.0E-170
sp|A5UAA8|ISCS_HAEIE Cysteine desulfurase IscS OS=Haemophilus influenzae (strain PittEE) GN=iscS PE=3 SV=1 79 478 1.0E-169
sp|A0KJ32|ISCS_AERHH Cysteine desulfurase IscS OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=iscS PE=3 SV=1 79 478 1.0E-169
sp|B7VJS6|ISCS_VIBTL Cysteine desulfurase IscS OS=Vibrio tasmaniensis (strain LGP32) GN=iscS PE=3 SV=1 79 478 2.0E-169
sp|A3D577|ISCS_SHEB5 Cysteine desulfurase IscS OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=iscS PE=3 SV=1 79 478 2.0E-169
sp|B0UVL5|ISCS_HISS2 Cysteine desulfurase IscS OS=Histophilus somni (strain 2336) GN=iscS PE=3 SV=1 79 478 4.0E-169
sp|B0TNY1|ISCS_SHEHH Cysteine desulfurase IscS OS=Shewanella halifaxensis (strain HAW-EB4) GN=iscS PE=3 SV=1 79 478 5.0E-169
sp|B8CMW5|ISCS_SHEPW Cysteine desulfurase IscS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=iscS PE=3 SV=1 79 478 8.0E-169
sp|Q0I1L2|ISCS_HAES1 Cysteine desulfurase IscS OS=Haemophilus somnus (strain 129Pt) GN=iscS PE=3 SV=1 79 478 1.0E-168
sp|Q1IEJ2|ISCS_PSEE4 Cysteine desulfurase IscS OS=Pseudomonas entomophila (strain L48) GN=iscS PE=3 SV=1 79 478 1.0E-168
sp|A4SP14|ISCS_AERS4 Cysteine desulfurase IscS OS=Aeromonas salmonicida (strain A449) GN=iscS PE=3 SV=1 79 478 3.0E-168
sp|Q6LU62|ISCS_PHOPR Cysteine desulfurase IscS OS=Photobacterium profundum GN=iscS PE=3 SV=1 79 478 7.0E-168
sp|C5BEU5|ISCS_EDWI9 Cysteine desulfurase IscS OS=Edwardsiella ictaluri (strain 93-146) GN=iscS PE=3 SV=1 79 478 3.0E-167
sp|Q7VMA9|ISCS_HAEDU Cysteine desulfurase IscS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=iscS PE=3 SV=1 79 478 3.0E-167
sp|B1JDR3|ISCS_PSEPW Cysteine desulfurase IscS OS=Pseudomonas putida (strain W619) GN=iscS PE=3 SV=1 79 478 1.0E-166
sp|B0KPH6|ISCS_PSEPG Cysteine desulfurase IscS OS=Pseudomonas putida (strain GB-1) GN=iscS PE=3 SV=1 79 478 3.0E-166
sp|Q88PK8|ISCS_PSEPK Cysteine desulfurase IscS OS=Pseudomonas putida (strain KT2440) GN=iscS PE=3 SV=1 79 478 1.0E-165
sp|A5VYS4|ISCS_PSEP1 Cysteine desulfurase IscS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=iscS PE=3 SV=1 79 478 1.0E-165
sp|Q4ZX34|ISCS_PSEU2 Cysteine desulfurase IscS OS=Pseudomonas syringae pv. syringae (strain B728a) GN=iscS PE=3 SV=1 79 478 3.0E-165
sp|Q48M05|ISCS_PSE14 Cysteine desulfurase IscS OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=iscS PE=3 SV=1 79 478 3.0E-165
sp|A4VNY2|ISCS_PSEU5 Cysteine desulfurase IscS OS=Pseudomonas stutzeri (strain A1501) GN=iscS PE=3 SV=1 79 478 3.0E-165
sp|Q887A1|ISCS_PSESM Cysteine desulfurase IscS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=iscS PE=3 SV=1 79 478 4.0E-165
sp|Q60C64|ISCS_METCA Cysteine desulfurase IscS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=iscS PE=3 SV=1 79 476 4.0E-164
sp|A5CWM6|ISCS_VESOH Cysteine desulfurase IscS OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=iscS PE=3 SV=1 79 478 9.0E-164
sp|B7UWH7|ISCS_PSEA8 Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain LESB58) GN=iscS PE=3 SV=1 79 478 6.0E-163
sp|Q9HXI8|ISCS_PSEAE Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=iscS PE=3 SV=1 79 478 2.0E-162
sp|Q02RW8|ISCS_PSEAB Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=iscS PE=3 SV=1 79 478 2.0E-162
sp|A6V0U8|ISCS_PSEA7 Cysteine desulfurase IscS OS=Pseudomonas aeruginosa (strain PA7) GN=iscS PE=3 SV=1 79 478 1.0E-161
sp|B8D8B6|ISCS_BUCAT Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=iscS PE=3 SV=1 79 475 2.0E-161
sp|P57657|ISCS_BUCAI Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscS PE=3 SV=1 79 475 2.0E-161
sp|B8D8F9|ISCS_BUCA5 Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=iscS PE=3 SV=1 79 475 2.0E-161
sp|A4XY43|ISCS_PSEMY Cysteine desulfurase IscS OS=Pseudomonas mendocina (strain ymp) GN=iscS PE=3 SV=1 79 478 2.0E-161
sp|Q2INI7|ISCS_ANADE Cysteine desulfurase IscS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=iscS PE=3 SV=1 79 477 6.0E-161
sp|B4UCP2|ISCS_ANASK Cysteine desulfurase IscS OS=Anaeromyxobacter sp. (strain K) GN=iscS PE=3 SV=1 79 477 8.0E-161
sp|B8JC53|ISCS_ANAD2 Cysteine desulfurase IscS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=iscS PE=3 SV=1 79 477 1.0E-160
sp|Q3K7A5|ISCS_PSEPF Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain Pf0-1) GN=iscS PE=3 SV=1 79 478 3.0E-160
sp|C3K1M5|ISCS_PSEFS Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain SBW25) GN=iscS PE=3 SV=1 79 478 4.0E-160
sp|Q4K6T8|ISCS_PSEF5 Cysteine desulfurase IscS OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=iscS PE=3 SV=1 79 478 1.0E-158
sp|C1DE68|ISCS_AZOVD Cysteine desulfurase IscS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=iscS PE=3 SV=1 79 478 2.0E-158
sp|O31269|ISCS_AZOVI Cysteine desulfurase IscS OS=Azotobacter vinelandii GN=iscS PE=1 SV=3 79 478 2.0E-158
sp|A1AWM1|ISCS_RUTMC Cysteine desulfurase IscS OS=Ruthia magnifica subsp. Calyptogena magnifica GN=iscS PE=3 SV=1 79 478 8.0E-158
sp|A7H804|ISCS_ANADF Cysteine desulfurase IscS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=iscS PE=3 SV=1 79 477 1.0E-156
sp|B0VD51|ISCS_ACIBY Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AYE) GN=iscS PE=3 SV=1 78 478 1.0E-156
sp|B2HZI5|ISCS_ACIBC Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain ACICU) GN=iscS PE=3 SV=1 78 478 1.0E-156
sp|B7I5Q3|ISCS_ACIB5 Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AB0057) GN=iscS PE=3 SV=1 78 478 1.0E-156
sp|B7H3H0|ISCS_ACIB3 Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain AB307-0294) GN=iscS PE=3 SV=1 78 478 1.0E-156
sp|B0VNW2|ISCS_ACIBS Cysteine desulfurase IscS OS=Acinetobacter baumannii (strain SDF) GN=iscS PE=3 SV=1 78 478 2.0E-156
sp|B2VI32|ISCS_ERWT9 Cysteine desulfurase IscS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=iscS PE=3 SV=1 79 467 2.0E-156
sp|O51886|ISCS_BUCAP Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=iscS PE=3 SV=1 79 477 6.0E-150
sp|Q89A19|ISCS_BUCBP Cysteine desulfurase IscS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=iscS PE=3 SV=1 79 478 4.0E-148
sp|Q43884|NIFS_TRIAZ Cysteine desulfurase OS=Trichormus azollae GN=nifS PE=3 SV=1 80 466 1.0E-117
sp|Q44507|NIFS1_ANAVT Cysteine desulfurase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifS1 PE=3 SV=2 80 466 1.0E-117
sp|P12623|NIFS_NOSS1 Cysteine desulfurase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifS PE=3 SV=3 80 466 2.0E-117
sp|P57795|ISCS_METTE Cysteine desulfurase IscS OS=Methanosarcina thermophila GN=iscS PE=3 SV=1 71 460 2.0E-116
sp|A5I4Z9|ISCS_CLOBH Cysteine desulfurase IscS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=iscS PE=3 SV=1 77 462 1.0E-113
sp|A7FWJ9|ISCS_CLOB1 Cysteine desulfurase IscS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=iscS PE=3 SV=1 77 462 1.0E-113
sp|C1FTC4|ISCS_CLOBJ Cysteine desulfurase IscS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=iscS PE=3 SV=1 77 462 3.0E-113
sp|Q44482|NIFS2_ANAVT Cysteine desulfurase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifS2 PE=3 SV=2 80 477 2.0E-112
sp|B8DZS1|ISCS_DICTD Cysteine desulfurase IscS OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=iscS PE=3 SV=1 78 463 3.0E-111
sp|O30052|ISCS1_ARCFU Cysteine desulfurase IscS 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscS1 PE=3 SV=2 81 461 9.0E-101
sp|O54055|ISCS_RUMFL Cysteine desulfurase IscS OS=Ruminococcus flavefaciens GN=iscS PE=1 SV=1 78 467 3.0E-99
sp|P05341|NIFS_AZOVI Cysteine desulfurase NifS OS=Azotobacter vinelandii GN=nifS PE=1 SV=4 80 461 3.0E-98
sp|Q52069|NIFS_ENTAG Cysteine desulfurase OS=Enterobacter agglomerans GN=nifS PE=3 SV=1 80 462 3.0E-96
sp|O34599|ISCS1_BACSU Putative cysteine desulfurase IscS 1 OS=Bacillus subtilis (strain 168) GN=iscS1 PE=3 SV=2 80 454 5.0E-96
sp|O29689|ISCS2_ARCFU Cysteine desulfurase IscS 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscS2 PE=1 SV=1 81 461 7.0E-96
sp|P57794|NIFS_GLUDA Cysteine desulfurase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=nifS PE=3 SV=1 80 462 1.0E-94
sp|P05344|NIFS_KLEPN Cysteine desulfurase OS=Klebsiella pneumoniae GN=nifS PE=3 SV=2 80 462 5.0E-94
sp|B2US50|ISCS_HELPS Cysteine desulfurase IscS OS=Helicobacter pylori (strain Shi470) GN=iscS PE=3 SV=1 80 458 4.0E-91
sp|Q9ZML2|ISCS_HELPJ Cysteine desulfurase IscS OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=iscS PE=3 SV=1 80 458 7.0E-90
sp|B6JKF2|ISCS_HELP2 Cysteine desulfurase IscS OS=Helicobacter pylori (strain P12) GN=iscS PE=3 SV=1 80 458 2.0E-89
sp|O25008|ISCS_HELPY Cysteine desulfurase IscS OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=iscS PE=1 SV=1 80 458 3.0E-89
sp|P37030|NIFS_BRADU Cysteine desulfurase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nifS PE=3 SV=2 79 458 6.0E-85
sp|P23120|NIFS_AZOCH Cysteine desulfurase OS=Azotobacter chroococcum mcd 1 GN=nifS PE=3 SV=3 80 461 6.0E-84
sp|Q01179|NIFS_RHOSH Cysteine desulfurase OS=Rhodobacter sphaeroides GN=nifS PE=3 SV=1 80 460 7.0E-81
sp|P55690|NIFS_RHISN Cysteine desulfurase OS=Rhizobium sp. (strain NGR234) GN=nifS PE=3 SV=1 78 461 1.0E-80
sp|Q9Z5X5|NIFS_FRASE Cysteine desulfurase OS=Frankia sp. (strain EuIK1) GN=nifS PE=3 SV=1 80 466 3.0E-78
sp|O34874|ISCS2_BACSU Putative cysteine desulfurase IscS 2 OS=Bacillus subtilis (strain 168) GN=iscS2 PE=3 SV=1 80 457 4.0E-78
sp|P70727|NIFS_AZOBR Cysteine desulfurase OS=Azospirillum brasilense GN=nifS PE=3 SV=1 80 468 1.0E-73
sp|A2VDS1|SCLY_BOVIN Selenocysteine lyase OS=Bos taurus GN=SCLY PE=2 SV=1 69 454 1.0E-72
sp|P9WQ71|ISCSL_MYCTU IscS-like cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=iscS PE=1 SV=1 81 447 2.0E-72
sp|P9WQ70|ISCSL_MYCTO Iscs-like cysteine desulfurase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=iscS PE=3 SV=1 81 447 2.0E-72
sp|Q68FT9|SCLY_RAT Selenocysteine lyase OS=Rattus norvegicus GN=Scly PE=1 SV=1 78 454 7.0E-69
sp|Q96I15|SCLY_HUMAN Selenocysteine lyase OS=Homo sapiens GN=SCLY PE=1 SV=4 78 458 2.0E-68
sp|Q07177|NIFS_RHOCA Cysteine desulfurase OS=Rhodobacter capsulatus GN=nifS PE=3 SV=1 77 455 3.0E-68
sp|Q9JLI6|SCLY_MOUSE Selenocysteine lyase OS=Mus musculus GN=Scly PE=1 SV=1 78 454 8.0E-68
sp|P31672|NIFS_LACDA NifS/IcsS protein homolog OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=Ldb0724 PE=3 SV=2 80 441 1.0E-67
sp|P38033|NIFS_BACSU Putative cysteine desulfurase NifS OS=Bacillus subtilis (strain 168) GN=nifS PE=2 SV=1 80 471 5.0E-63
sp|Q66IQ6|SCLY_XENLA Selenocysteine lyase OS=Xenopus laevis GN=scly PE=2 SV=1 80 447 5.0E-61
sp|Q5U4Q9|SCLY_XENTR Selenocysteine lyase OS=Xenopus tropicalis GN=scly PE=2 SV=2 80 447 6.0E-61
sp|Q9KDJ6|NIFS_BACHD Putative cysteine desulfurase NifS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nifS PE=3 SV=1 80 453 5.0E-59
sp|Q9HMM6|CSD_HALSA Probable cysteine desulfurase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=csd PE=3 SV=1 58 457 2.0E-35
sp|Q9YAB6|CSD_AERPE Probable cysteine desulfurase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=csd PE=3 SV=1 55 342 9.0E-33
sp|D4GYV5|SUFS_HALVD Cysteine desulfurase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=sufS PE=1 SV=1 60 457 2.0E-32
sp|Q9K7A0|CSD_BACHD Probable cysteine desulfurase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=csd PE=3 SV=2 80 307 2.0E-31
sp|P99177|CSD_STAAN Probable cysteine desulfurase OS=Staphylococcus aureus (strain N315) GN=csd PE=1 SV=1 65 331 5.0E-31
sp|P63518|CSD_STAAM Probable cysteine desulfurase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=csd PE=3 SV=1 65 331 5.0E-31
sp|Q8NXH0|CSD_STAAW Probable cysteine desulfurase OS=Staphylococcus aureus (strain MW2) GN=csd PE=3 SV=1 65 331 5.0E-31
sp|Q6GB11|CSD_STAAS Probable cysteine desulfurase OS=Staphylococcus aureus (strain MSSA476) GN=csd PE=3 SV=1 65 331 5.0E-31
sp|Q6GIH2|CSD_STAAR Probable cysteine desulfurase OS=Staphylococcus aureus (strain MRSA252) GN=csd PE=3 SV=1 65 331 5.0E-31
sp|Q5HHH0|CSD_STAAC Probable cysteine desulfurase OS=Staphylococcus aureus (strain COL) GN=csd PE=3 SV=1 65 331 5.0E-31
sp|P57989|CSD_PASMU Probable cysteine desulfurase OS=Pasteurella multocida (strain Pm70) GN=csd PE=3 SV=1 62 441 3.0E-30
sp|Q9V242|CSD_PYRAB Probable cysteine desulfurase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=csd PE=3 SV=1 80 308 4.0E-30
sp|Q9KII6|CSD_MYCPA Probable cysteine desulfurase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_2120c PE=3 SV=1 34 334 7.0E-30
sp|P9WQ69|CSD_MYCTU Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=csd PE=1 SV=1 58 331 4.0E-29
sp|P9WQ68|CSD_MYCTO Probable cysteine desulfurase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=csd PE=3 SV=1 58 331 4.0E-29
sp|P63517|CSD_MYCBO Probable cysteine desulfurase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=csd PE=3 SV=1 58 331 4.0E-29
sp|O27442|CSD_METTH Probable cysteine desulfurase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=csd PE=3 SV=1 80 327 3.0E-28
sp|A7FHJ2|SUFS_YERP3 Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sufS PE=3 SV=1 63 348 6.0E-28
sp|B1JJ48|SUFS_YERPY Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sufS PE=3 SV=1 63 307 1.0E-27
sp|A4TIP2|SUFS_YERPP Cysteine desulfurase OS=Yersinia pestis (strain Pestoides F) GN=sufS PE=3 SV=1 63 307 1.0E-27
sp|Q1CIJ6|SUFS_YERPN Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sufS PE=3 SV=1 63 307 1.0E-27
sp|Q8D0M6|SUFS_YERPE Cysteine desulfurase OS=Yersinia pestis GN=sufS PE=3 SV=2 63 307 1.0E-27
sp|Q1C761|SUFS_YERPA Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sufS PE=3 SV=1 63 307 1.0E-27
sp|Q5HQQ0|CSD_STAEQ Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=csd PE=3 SV=1 65 450 1.0E-27
sp|Q8CTA4|CSD_STAES Probable cysteine desulfurase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=csd PE=3 SV=1 65 450 1.0E-27
sp|A8GDU4|SUFS_SERP5 Cysteine desulfurase OS=Serratia proteamaculans (strain 568) GN=sufS PE=3 SV=1 65 317 1.0E-27
sp|Q9PLP0|CSD_CHLMU Probable cysteine desulfurase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=csd PE=3 SV=1 80 447 2.0E-27
sp|Q66A22|SUFS_YERPS Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sufS PE=3 SV=1 63 307 2.0E-27
sp|A9QZC9|SUFS_YERPG Cysteine desulfurase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sufS PE=3 SV=1 63 307 2.0E-27
sp|B2K5J4|SUFS_YERPB Cysteine desulfurase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sufS PE=3 SV=1 63 307 2.0E-27
sp|O84693|CSD_CHLTR Probable cysteine desulfurase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=csd PE=3 SV=1 80 447 9.0E-27
sp|Q9XAD5|CSD_STRCO Probable cysteine desulfurase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=csd PE=3 SV=1 58 329 3.0E-26
sp|Q57476|CSD_HAEIN Probable cysteine desulfurase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=csd PE=3 SV=1 68 307 4.0E-26
sp|Q49690|CSD2_MYCLE Probable cysteine desulfurase 2 OS=Mycobacterium leprae (strain TN) GN=csd2 PE=3 SV=1 58 331 5.0E-26
sp|Q9KPQ7|CSD_VIBCH Probable cysteine desulfurase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=csd PE=3 SV=1 62 322 8.0E-26
sp|Q9Z7L5|CSD_CHLPN Probable cysteine desulfurase OS=Chlamydia pneumoniae GN=csd PE=3 SV=1 59 455 2.0E-25
sp|O32164|SUFS_BACSU Cysteine desulfurase SufS OS=Bacillus subtilis (strain 168) GN=sufS PE=1 SV=1 80 329 4.0E-25
sp|A4W9R3|SUFS_ENT38 Cysteine desulfurase OS=Enterobacter sp. (strain 638) GN=sufS PE=3 SV=1 81 307 4.0E-25
sp|O32975|CSD1_MYCLE Probable cysteine desulfurase 1 OS=Mycobacterium leprae (strain TN) GN=csd1 PE=3 SV=1 58 334 6.0E-25
sp|Q9HXX3|CSD_PSEAE Probable cysteine desulfurase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=csd PE=3 SV=1 81 327 7.0E-25
sp|Q9PQ36|CSD_UREPA Probable cysteine desulfurase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=csd PE=3 SV=1 73 308 2.0E-24
sp|Q6D625|SUFS_PECAS Cysteine desulfurase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sufS PE=3 SV=1 63 316 2.0E-24
sp|Q9EXP2|SUFS_DICD3 Cysteine desulfurase OS=Dickeya dadantii (strain 3937) GN=sufS PE=1 SV=1 63 317 2.0E-24
sp|O51111|CSD_BORBU Probable cysteine desulfurase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=csd PE=3 SV=1 80 331 1.0E-23
sp|Q8D2J7|SUFS_WIGBR Cysteine desulfurase OS=Wigglesworthia glossinidia brevipalpis GN=sufS PE=3 SV=1 80 458 8.0E-23
sp|C6DKM6|SUFS_PECCP Cysteine desulfurase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=sufS PE=3 SV=1 63 317 1.0E-22
sp|Q3Z233|SUFS_SHISS Cysteine desulfurase OS=Shigella sonnei (strain Ss046) GN=sufS PE=3 SV=1 81 307 2.0E-22
sp|Q55793|CSD_SYNY3 Probable cysteine desulfurase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=csd PE=1 SV=1 80 451 2.0E-22
sp|Q46925|CSDA_ECOLI Cysteine desulfurase CsdA OS=Escherichia coli (strain K12) GN=csdA PE=1 SV=1 51 457 4.0E-22
sp|Q93WX6|CNIF1_ARATH Cysteine desulfurase 1, chloroplastic OS=Arabidopsis thaliana GN=NFS2 PE=1 SV=1 77 307 5.0E-22
sp|Q7UAH4|SUFS_SHIFL Cysteine desulfurase OS=Shigella flexneri GN=sufS PE=3 SV=1 81 307 5.0E-22
sp|B5Z4B3|SUFS_ECO5E Cysteine desulfurase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|Q7ADI4|SUFS_ECO57 Cysteine desulfurase OS=Escherichia coli O157:H7 GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|Q1RBB6|SUFS_ECOUT Cysteine desulfurase OS=Escherichia coli (strain UTI89 / UPEC) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|B6IBB9|SUFS_ECOSE Cysteine desulfurase OS=Escherichia coli (strain SE11) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|A1ABL8|SUFS_ECOK1 Cysteine desulfurase OS=Escherichia coli O1:K1 / APEC GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|B7MV59|SUFS_ECO81 Cysteine desulfurase OS=Escherichia coli O81 (strain ED1a) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|B7L5N2|SUFS_ECO55 Cysteine desulfurase OS=Escherichia coli (strain 55989 / EAEC) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|B7MA32|SUFS_ECO45 Cysteine desulfurase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|P77444|SUFS_ECOLI Cysteine desulfurase OS=Escherichia coli (strain K12) GN=sufS PE=1 SV=1 81 307 6.0E-22
sp|B1XFY8|SUFS_ECODH Cysteine desulfurase OS=Escherichia coli (strain K12 / DH10B) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|C4ZYE2|SUFS_ECOBW Cysteine desulfurase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|B7N516|SUFS_ECOLU Cysteine desulfurase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sufS PE=3 SV=1 81 307 6.0E-22
sp|Q8FH54|SUFS_ECOL6 Cysteine desulfurase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sufS PE=3 SV=1 81 307 7.0E-22
sp|B7US19|SUFS_ECO27 Cysteine desulfurase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sufS PE=3 SV=1 81 307 7.0E-22
sp|Q7N3U5|SUFS_PHOLL Cysteine desulfurase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sufS PE=3 SV=1 80 308 1.0E-21
sp|B7LQ96|SUFS_ESCF3 Cysteine desulfurase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B1LE56|SUFS_ECOSM Cysteine desulfurase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B5F7C4|SUFS_SALA4 Cysteine desulfurase OS=Salmonella agona (strain SL483) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B5RAT4|SUFS_SALG2 Cysteine desulfurase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|Q7CQN5|SUFS_SALTY Cysteine desulfurase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|Q8XF77|SUFS_SALTI Cysteine desulfurase OS=Salmonella typhi GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B4T4R6|SUFS_SALNS Cysteine desulfurase OS=Salmonella newport (strain SL254) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B4TGK9|SUFS_SALHS Cysteine desulfurase OS=Salmonella heidelberg (strain SL476) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B5QVS9|SUFS_SALEP Cysteine desulfurase OS=Salmonella enteritidis PT4 (strain P125109) GN=sufS PE=3 SV=1 81 307 1.0E-21
sp|B4TUT5|SUFS_SALSV Cysteine desulfurase OS=Salmonella schwarzengrund (strain CVM19633) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|Q9PDA6|CSD_XYLFA Probable cysteine desulfurase OS=Xylella fastidiosa (strain 9a5c) GN=csd PE=3 SV=1 62 408 2.0E-21
sp|A9N142|SUFS_SALPB Cysteine desulfurase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|Q57PR2|SUFS_SALCH Cysteine desulfurase OS=Salmonella choleraesuis (strain SC-B67) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|B5FIM3|SUFS_SALDC Cysteine desulfurase OS=Salmonella dublin (strain CT_02021853) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|B7NTV6|SUFS_ECO7I Cysteine desulfurase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|B7M0N5|SUFS_ECO8A Cysteine desulfurase OS=Escherichia coli O8 (strain IAI1) GN=sufS PE=3 SV=1 81 307 2.0E-21
sp|Q321D9|SUFS_SHIBS Cysteine desulfurase OS=Shigella boydii serotype 4 (strain Sb227) GN=sufS PE=3 SV=1 81 307 4.0E-21
sp|B2U2I4|SUFS_SHIB3 Cysteine desulfurase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sufS PE=3 SV=1 81 307 4.0E-21
sp|A9MEP3|SUFS_SALAR Cysteine desulfurase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=sufS PE=3 SV=1 81 307 1.0E-20
sp|Q0THE9|SUFS_ECOL5 Cysteine desulfurase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sufS PE=3 SV=1 81 307 1.0E-20
sp|A7ZME5|SUFS_ECO24 Cysteine desulfurase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sufS PE=3 SV=1 81 307 1.0E-20
sp|Q9Z408|CSD_PSEPK Probable cysteine desulfurase OS=Pseudomonas putida (strain KT2440) GN=csdA PE=3 SV=1 81 350 1.0E-20
sp|A8A0M6|SUFS_ECOHS Cysteine desulfurase OS=Escherichia coli O9:H4 (strain HS) GN=sufS PE=3 SV=1 81 307 2.0E-20
sp|A8AH80|SUFS_CITK8 Cysteine desulfurase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sufS PE=3 SV=1 81 349 3.0E-20
sp|Q87DJ2|CSD_XYLFT Probable cysteine desulfurase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=csd PE=3 SV=1 62 408 4.0E-20
sp|B1IQ76|SUFS_ECOLC Cysteine desulfurase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sufS PE=3 SV=1 81 307 7.0E-20
sp|B5XQH2|SUFS_KLEP3 Cysteine desulfurase OS=Klebsiella pneumoniae (strain 342) GN=sufS PE=3 SV=1 81 307 5.0E-19
sp|A7MF59|SUFS_CROS8 Cysteine desulfurase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=sufS PE=3 SV=1 81 307 6.0E-19
sp|A6TAE4|SUFS_KLEP7 Cysteine desulfurase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sufS PE=3 SV=1 80 307 1.0E-18
sp|Q9X191|CSD_THEMA Probable cysteine desulfurase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=csd PE=3 SV=1 61 307 9.0E-18
sp|Q49420|CSD_MYCGE Probable cysteine desulfurase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=csd PE=3 SV=1 80 402 1.0E-17
sp|P71379|Y1343_HAEIN Putative csd-like protein HI_1343 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1343 PE=5 SV=1 191 307 2.0E-17
sp|O83623|CSD_TREPA Probable cysteine desulfurase OS=Treponema pallidum (strain Nichols) GN=csd PE=3 SV=1 81 308 5.0E-17
sp|P75298|CSD_MYCPN Probable cysteine desulfurase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=csd PE=3 SV=1 108 307 4.0E-16
sp|Q10089|YAOA_SCHPO Uncharacterized protein C11D3.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.10 PE=3 SV=1 57 440 2.0E-13
sp|P42253|YCBU_BACSU Uncharacterized aminotransferase YcbU OS=Bacillus subtilis (strain 168) GN=ycbU PE=3 SV=3 118 366 1.0E-12
sp|A0R5M7|EGTE_MYCS2 Probable hercynylcysteine sulfoxide lyase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtE PE=3 SV=1 120 302 1.0E-09
sp|Q03046|CEFD_AMYLA Isopenicillin N epimerase OS=Amycolatopsis lactamdurans GN=cefD PE=3 SV=1 127 288 1.0E-07
sp|Q183T0|PHNXW_PEPD6 Bifunctional phosphonoacetaldehyde hydrolase/aminoethylphosphonate transaminase OS=Peptoclostridium difficile (strain 630) GN=phnXW PE=3 SV=1 118 288 2.0E-07
sp|P0C9D1|NIFSL_ASFK5 NifS-like protein OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-136 PE=3 SV=1 117 445 5.0E-07
sp|Q54RV9|SGPL_DICDI Sphingosine-1-phosphate lyase OS=Dictyostelium discoideum GN=sglA PE=2 SV=1 131 340 7.0E-07
sp|Q9UZD5|MFNA_PYRAB Probable L-aspartate decarboxylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mfnA PE=3 SV=1 125 357 8.0E-07
sp|Q9N0E7|MOCOS_BOVIN Molybdenum cofactor sulfurase OS=Bos taurus GN=MOCOS PE=2 SV=3 80 316 2.0E-06
sp|Q39AP8|PHNW1_BURL3 2-aminoethylphosphonate--pyruvate transaminase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=phnW1 PE=3 SV=1 185 294 3.0E-06
sp|O58679|MFNA_PYRHO L-aspartate/L-glutamate decarboxylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mfnA PE=1 SV=1 125 357 3.0E-06
sp|Q65236|NIFSL_ASFM2 NifS-like protein OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-132 PE=3 SV=1 117 372 4.0E-06
sp|B1Z0T3|PHNW_BURA4 2-aminoethylphosphonate--pyruvate transaminase OS=Burkholderia ambifaria (strain MC40-6) GN=phnW PE=3 SV=1 102 294 5.0E-06
sp|B1HPR6|PHNW_LYSSC 2-aminoethylphosphonate--pyruvate transaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=phnW PE=3 SV=1 209 288 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0016829 lyase activity Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0044281 small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056140
MLARLARNATVHRTCAKSVVASCQNRRSFVQPSGADRASVMDVPSTYKEENHFTPRADMLGFKLEVPRREDSVKG
KTRPIYLDMQATTPVDPRVLDAMLPYLTDQYGNPHSRTHAYGWEAEQAVEDARKYVADLIGADQKDIIFTSGATE
SNNLSIKGIARFHKERKRHIITTQTEHKCVLDSCRKLSEEGFDITYLPVQKSGIVDLQELEAAIRPDTSLVTIMT
VNNETGVIQPIKEIGEIVRKHRGVYFHTDAAQAVGKIPLDVNEMNIDLMSISGHKLYGPKGIGAAYVRRRPRVRL
EPILSGGGQERGLRSGTLPTALAVGLGEAARIAQSEMTRDHVRIKELSDRLIKKINDKMEHVVRNGDSNGYPGCV
NLSFSYVEGESLLMALKDIALSSGSACTSASLEPSYVLRALGAAEDMAHSSLRFGIGRFTTEAEIDFVVEHLVRT
VDRLREMSPLWEMVQEGIDINSIDWSQH*
Coding >AgabiH97|056140
ATGTTGGCTAGGCTCGCTCGCAATGCAACTGTTCACCGCACTTGCGCAAAGTCTGTGGTGGCATCGTGCCAAAAC
CGACGGTCATTCGTGCAACCGTCTGGTGCAGACAGAGCAAGTGTAATGGATGTACCCTCCACATACAAAGAAGAA
AATCATTTTACCCCACGGGCAGATATGCTTGGCTTCAAACTCGAGGTACCTCGACGTGAAGATTCTGTGAAGGGT
AAAACCAGGCCAATTTACTTGGATATGCAGGCCACTACTCCCGTTGACCCTCGTGTGTTGGATGCTATGCTTCCG
TATCTTACAGATCAATATGGCAATCCTCATAGTAGGACTCATGCGTACGGTTGGGAGGCCGAGCAAGCCGTTGAA
GATGCACGTAAATACGTTGCAGACTTGATTGGCGCAGACCAAAAAGACATCATATTCACCTCTGGAGCAACCGAG
TCCAACAATCTCTCCATCAAGGGAATAGCACGTTTTCACAAGGAAAGAAAACGTCATATCATCACAACGCAAACA
GAGCACAAATGTGTACTCGACTCATGCCGGAAACTTAGTGAGGAGGGTTTTGACATCACTTATCTGCCGGTGCAG
AAGAGTGGAATAGTCGATCTTCAAGAACTCGAAGCTGCTATCCGGCCTGATACCTCACTGGTGACGATTATGACT
GTGAACAACGAAACAGGCGTTATACAGCCAATCAAAGAAATTGGAGAGATCGTTCGCAAACATCGAGGTGTTTAC
TTTCACACGGACGCTGCACAAGCCGTTGGCAAGATACCTTTGGATGTGAACGAAATGAATATCGACTTGATGAGC
ATTTCCGGTCACAAGTTATATGGTCCTAAAGGTATCGGTGCGGCATATGTCAGGAGGCGACCTAGGGTTAGATTG
GAACCGATACTCAGCGGAGGCGGTCAAGAGCGTGGACTCAGAAGTGGGACACTTCCTACTGCATTGGCTGTCGGC
TTAGGCGAAGCTGCTCGGATTGCACAGAGCGAAATGACTAGAGATCATGTTCGCATTAAAGAGCTTTCTGACCGA
CTGATCAAAAAAATCAATGATAAGATGGAACATGTTGTGCGGAACGGCGATTCCAACGGATACCCAGGTTGTGTA
AACCTCAGTTTCTCGTATGTCGAGGGCGAAAGTTTGCTTATGGCACTCAAGGATATTGCACTTTCGTCTGGAAGT
GCTTGTACGTCGGCATCTTTAGAACCTTCCTACGTACTTCGCGCTCTTGGTGCCGCAGAGGACATGGCCCATTCC
TCCTTGAGATTTGGCATTGGGCGGTTTACGACCGAAGCGGAGATCGATTTTGTAGTAGAGCACCTTGTTAGAACC
GTTGACCGACTCCGCGAGATGAGTCCATTATGGGAGATGGTACAGGAAGGCATTGATATCAACTCAATTGACTGG
TCACAACATTAA
Transcript >AgabiH97|056140
ATGTTGGCTAGGCTCGCTCGCAATGCAACTGTTCACCGCACTTGCGCAAAGTCTGTGGTGGCATCGTGCCAAAAC
CGACGGTCATTCGTGCAACCGTCTGGTGCAGACAGAGCAAGTGTAATGGATGTACCCTCCACATACAAAGAAGAA
AATCATTTTACCCCACGGGCAGATATGCTTGGCTTCAAACTCGAGGTACCTCGACGTGAAGATTCTGTGAAGGGT
AAAACCAGGCCAATTTACTTGGATATGCAGGCCACTACTCCCGTTGACCCTCGTGTGTTGGATGCTATGCTTCCG
TATCTTACAGATCAATATGGCAATCCTCATAGTAGGACTCATGCGTACGGTTGGGAGGCCGAGCAAGCCGTTGAA
GATGCACGTAAATACGTTGCAGACTTGATTGGCGCAGACCAAAAAGACATCATATTCACCTCTGGAGCAACCGAG
TCCAACAATCTCTCCATCAAGGGAATAGCACGTTTTCACAAGGAAAGAAAACGTCATATCATCACAACGCAAACA
GAGCACAAATGTGTACTCGACTCATGCCGGAAACTTAGTGAGGAGGGTTTTGACATCACTTATCTGCCGGTGCAG
AAGAGTGGAATAGTCGATCTTCAAGAACTCGAAGCTGCTATCCGGCCTGATACCTCACTGGTGACGATTATGACT
GTGAACAACGAAACAGGCGTTATACAGCCAATCAAAGAAATTGGAGAGATCGTTCGCAAACATCGAGGTGTTTAC
TTTCACACGGACGCTGCACAAGCCGTTGGCAAGATACCTTTGGATGTGAACGAAATGAATATCGACTTGATGAGC
ATTTCCGGTCACAAGTTATATGGTCCTAAAGGTATCGGTGCGGCATATGTCAGGAGGCGACCTAGGGTTAGATTG
GAACCGATACTCAGCGGAGGCGGTCAAGAGCGTGGACTCAGAAGTGGGACACTTCCTACTGCATTGGCTGTCGGC
TTAGGCGAAGCTGCTCGGATTGCACAGAGCGAAATGACTAGAGATCATGTTCGCATTAAAGAGCTTTCTGACCGA
CTGATCAAAAAAATCAATGATAAGATGGAACATGTTGTGCGGAACGGCGATTCCAACGGATACCCAGGTTGTGTA
AACCTCAGTTTCTCGTATGTCGAGGGCGAAAGTTTGCTTATGGCACTCAAGGATATTGCACTTTCGTCTGGAAGT
GCTTGTACGTCGGCATCTTTAGAACCTTCCTACGTACTTCGCGCTCTTGGTGCCGCAGAGGACATGGCCCATTCC
TCCTTGAGATTTGGCATTGGGCGGTTTACGACCGAAGCGGAGATCGATTTTGTAGTAGAGCACCTTGTTAGAACC
GTTGACCGACTCCGCGAGATGAGTCCATTATGGGAGATGGTACAGGAAGGCATTGATATCAACTCAATTGACTGG
TCACAACATTAA
Gene >AgabiH97|056140
ATGTTGGCTAGGCTCGCTCGCAATGCAACTGTTCACCGCACTTGCGCAAAGTCTGTGGTGGCATCGTGCCAAAAC
CGACGGTCATTCGTGCAACCGTCTGGTGCAGACAGAGCAAGTGTAATGGATGTACCCTCCACATACAAAGAAGAA
AATCATTTTACCCCACGGGCAGGTTTGTCGTCCACGTCACTCATGGGTCGGACACTTTTTCACGTAGACAGATAT
GCTTGGCTTCAAACTCGAGGTACCTCGACGTGAAGATTCTGTGAAGGGTAAAACCAGGCCAATTTACTTGGATAT
GCAGGTGGGAACTGCAAATTGCGTTTTTTCTATCCCGTTCATATCTTTTCCTAGGCCACTACTCCCGTTGACCCT
CGTGTGTTGGATGCTATGCTTCCGTATCTTACAGATCAATATGGCAATCCTCATAGTAGGACTCATGCGTACGGT
TGGGAGGCCGAGCAAGCCGTTGAAGATGCACGTAAAGTACGCGTTTCTTCTCTTTGTTTTTTTGTTCATGTGTCT
CAATTTCCTCCTCAGTACGTTGCAGACTTGATTGGCGCAGACCAAAAAGACATCATATTCACCTCTGGAGCAACC
GAGTCCAACAATCTCTCCATCAAGGGAATAGCACGTTTTCACAAGGAAAGAAAACGTCATATCATCACAACGCAA
ACAGTACGTCCATTCAGAGTGCTTACACATTAGTTTTACTTACCGACAAGTCAGGAGCACAAATGTGTACTCGAC
TCATGCCGGAAACTTAGTGAGGAGGGTTTTGACATCACTTATCTGCCGGTGCAGAAGAGTGGAATAGTCGATCTT
CAAGAACTCGAAGCTGCTATCCGGCCTGATACCTCACTGGTGACGATTATGACTGTGAACAACGAAACAGGCGTT
ATACAGCCAATCAAAGAAATTGGAGAGATCGTTCGCAAACATCGAGGTGTTTACTTTCACACGGACGCTGCACAA
GCCGTTGGCAAGATACCTTTGGATGTGAACGAAATGAATATCGACTTGATGAGCATTTCCGGTCACAAGTTATAT
GGTCCTAAAGGTATCGGTGCGGCATATGTCAGGAGGCGACCTAGGGTTAGATTGGAACCGATACTCAGCGGAGGC
GGTCAAGAGCGTGGACTCAGAAGTGGGACACTTCCTACTGCATTGGCTGTCGGCTTAGGCGAAGCTGCTCGGATT
GCACAGAGCGAAATGACTGTGAGTAATAAGCTGATCCCTTTCCTCTTGATGATTCTTGCGCGCTTTCATTTGTTA
ACATGAGTCGCGTGATGTGGTGATATTTAATCGCCAATCAGCCTGGCCATGATGTTTGTGCAGGGGTACTGACAC
AGTGTTTCTTACTTCCTCTTCTATGTCTATGATGAGCCCGTACTGATTTGGGGTTATGACAGAGAGATCATGTTC
GCATTAAAGAGCTTTCTGACCGACTGATCAAAAAAATCAATGATAAGATGGAACATGTTGTGCGGAACGGCGATT
CCAACGGATACCCAGGTTGTGTAAACCTCAGTTTCTCGTATGTCGAGGGCGAAAGTTTGCTTATGGCACTCAAGG
TGTGACAAATCTTCGTGCTCAATCTATAGCTTAGGTATTGATTACAATGACAGGATATTGCACTTTCGTCTGGAA
GTGCTTGTACGTCGGCATCTTTAGAACCTTCCTACGTACTTCGCGCTCTTGGTGAGATCATTCATGATCTGGAGC
TCCTAGCATTGACATATTATACTATAGGTGCCGCAGAGGACATGGCCCATTCCTCCTTGAGATTTGGCATTGGGC
GGTTTACGACCGAAGCGGAGATCGATTTTGTAGTAGAGCACCTTGTTAGAACCGTTGACCGACTCCGCGAGATGA
GGTATGTGTCACTGATTTTTCTGGGATTGAATTGCTCTGACAACAGCTTCAGTCCATTATGGGAGATGGTACAGG
AAGGCATTGATATCAACTCAATTGACTGGTCACAACATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail