Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056110
Gene name
Locationscaffold_3:843119..844901
Strand-
Gene length (bp)1782
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 6.1E-110 19 363
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 3.3E-23 15 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 6 365 2.0E-71
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 2 364 2.0E-70
sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 5 363 4.0E-70
sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 3 363 7.0E-69
sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 23 363 7.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 6 365 2.0E-71
sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 2 364 2.0E-70
sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 5 363 4.0E-70
sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 3 363 7.0E-69
sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 23 363 7.0E-69
sp|Q28FR6|HIBCH_XENTR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 23 363 1.0E-68
sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 5 363 5.0E-68
sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 1 364 9.0E-68
sp|O74802|HIBCH_SCHPO 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 3 347 1.0E-67
sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 1 364 2.0E-67
sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 5 363 2.0E-66
sp|Q55GS6|HIBCH_DICDI 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Dictyostelium discoideum GN=hibch PE=3 SV=1 1 367 5.0E-64
sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 2 381 4.0E-60
sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 10 386 1.0E-59
sp|Q2HJ73|HIBCH_BOVIN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Bos taurus GN=HIBCH PE=2 SV=1 2 362 1.0E-56
sp|P28817|HIBCH_YEAST 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHD3 PE=1 SV=2 8 464 4.0E-55
sp|Q9SHJ8|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=1 SV=2 7 384 1.0E-52
sp|Q9LK08|HIBC7_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=At3g24360 PE=2 SV=1 23 368 3.0E-39
sp|Q9T0K7|HIBC6_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana GN=At4g13360 PE=1 SV=2 23 368 3.0E-39
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 9 217 3.0E-20
sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 9 162 2.0E-17
sp|Q869N6|CRTL_DICDI 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 7 195 2.0E-16
sp|P9WNN9|ECHA8_MYCTU Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 9 204 7.0E-16
sp|P9WNN8|ECHA8_MYCTO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 9 204 7.0E-16
sp|P64017|ECHA8_MYCBO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 9 204 7.0E-16
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 9 163 2.0E-15
sp|P52046|CRT_CLOAB Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 9 197 2.0E-14
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 6 163 4.0E-14
sp|Q1ZXF1|ECHM_DICDI Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 23 217 6.0E-14
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 15 195 9.0E-14
sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 17 195 2.0E-13
sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 15 201 2.0E-13
sp|P41942|YKB4_CAEEL Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 10 248 9.0E-13
sp|Q58DM8|ECHM_BOVIN Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 15 191 2.0E-12
sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 23 201 3.0E-12
sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 23 165 3.0E-12
sp|Q5R646|ECHM_PONAB Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 23 201 4.0E-12
sp|A0PJR5|ECHD3_DANRE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Danio rerio GN=echdc3 PE=2 SV=2 6 148 5.0E-12
sp|Q9LCU3|CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 6 223 1.0E-11
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 17 209 1.0E-11
sp|Q50130|ECHA6_MYCLE Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 23 189 1.0E-11
sp|O85078|CBAD1_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 6 223 1.0E-11
sp|Q62651|ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 23 165 2.0E-11
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 17 209 2.0E-11
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 17 209 3.0E-11
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 17 209 3.0E-11
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 17 209 3.0E-11
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 17 209 3.0E-11
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 15 190 5.0E-11
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 17 209 5.0E-11
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 17 209 6.0E-11
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 17 209 6.0E-11
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 17 209 6.0E-11
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 17 209 7.0E-11
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 17 209 7.0E-11
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 17 209 7.0E-11
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 17 209 7.0E-11
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 17 209 8.0E-11
sp|Q86YB7|ECHD2_HUMAN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 16 190 8.0E-11
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 17 209 1.0E-10
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 15 190 2.0E-10
sp|P23966|MENB_BACSU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 10 163 2.0E-10
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 22 191 2.0E-10
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 28 192 9.0E-10
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|Q8GYN9|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 18 162 1.0E-09
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|P76082|PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 10 192 1.0E-09
sp|P0ABU0|MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) GN=menB PE=1 SV=1 13 163 1.0E-09
sp|P0ABU1|MENB_ECOL6 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=menB PE=3 SV=1 13 163 1.0E-09
sp|P77467|PAAG_ECOLI 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 10 217 1.0E-09
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 17 209 1.0E-09
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 28 192 1.0E-09
sp|Q5RFG0|ECH1_PONAB Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 23 166 1.0E-09
sp|Q7CQ56|MENB_SALTY 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menB PE=1 SV=1 13 163 2.0E-09
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 28 229 2.0E-09
sp|P44960|MENB_HAEIN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 13 163 2.0E-09
sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 23 165 2.0E-09
sp|P9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 23 200 3.0E-09
sp|P9WNP0|ECHA6_MYCTO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 23 200 3.0E-09
sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 23 200 3.0E-09
sp|Q5LLW6|DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 23 189 3.0E-09
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 28 191 4.0E-09
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 28 191 4.0E-09
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 28 191 4.0E-09
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 28 191 4.0E-09
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 28 191 4.0E-09
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 28 191 4.0E-09
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 28 192 4.0E-09
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 28 192 4.0E-09
sp|Q54SS0|ECH1_DICDI Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 18 191 5.0E-09
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 10 191 5.0E-09
sp|Q7U004|ECH12_MYCBO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA12 PE=3 SV=1 18 217 6.0E-09
sp|A1S1I8|FADB_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 8 162 6.0E-09
sp|Q54HG7|AUHM_DICDI Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 23 249 8.0E-09
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 30 187 8.0E-09
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 23 190 9.0E-09
sp|Q5E3U1|FADJ_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 29 198 1.0E-08
sp|Q9CLV5|MENB_PASMU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 10 163 1.0E-08
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 30 192 1.0E-08
sp|Q4L549|MENB_STAHJ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 10 162 2.0E-08
sp|B0VLX4|FADB_ACIBS Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 48 162 2.0E-08
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 52 191 2.0E-08
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 10 163 2.0E-08
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 28 225 2.0E-08
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 18 238 2.0E-08
sp|Q3MIE0|ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus GN=Echdc3 PE=2 SV=1 15 253 2.0E-08
sp|P9WNN7|ECH12_MYCTU Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA12 PE=1 SV=1 18 217 3.0E-08
sp|P9WNN6|ECH12_MYCTO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA12 PE=3 SV=1 18 217 3.0E-08
sp|Q87MM3|FADJ_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 49 191 3.0E-08
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 23 190 3.0E-08
sp|A8FP63|FADB_SHESH Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1 8 162 3.0E-08
sp|Q78JN3|ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus GN=Eci3 PE=1 SV=1 10 191 4.0E-08
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 49 191 4.0E-08
sp|Q8GB17|CAID_PROSL Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 14 223 4.0E-08
sp|B4EY26|CAID_PROMH Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 14 223 4.0E-08
sp|B0VE45|FADB_ACIBY Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 48 162 4.0E-08
sp|B7I3P1|FADB_ACIB5 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 48 162 4.0E-08
sp|B7H1I0|FADB_ACIB3 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 48 162 4.0E-08
sp|B2I2J9|FADB_ACIBC Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 48 162 4.0E-08
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 8 162 5.0E-08
sp|Q9KT58|FADJ_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 54 200 5.0E-08
sp|A5F2P2|FADJ_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 54 200 5.0E-08
sp|O07533|YHAR_BACSU Putative enoyl-CoA hydratase/isomerase YhaR OS=Bacillus subtilis (strain 168) GN=yhaR PE=3 SV=4 10 163 5.0E-08
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 8 162 6.0E-08
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 8 162 6.0E-08
sp|Q8NXA0|MENB_STAAW 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 10 162 6.0E-08
sp|Q6GAG7|MENB_STAAS 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 10 162 6.0E-08
sp|B1KCZ3|FADB_SHEWM Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 8 162 7.0E-08
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 8 162 7.0E-08
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 8 162 7.0E-08
sp|P53526|ECH12_MYCLE Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 23 162 8.0E-08
sp|A0KR50|FADB_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 8 162 8.0E-08
sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=1 SV=1 15 253 9.0E-08
sp|Q8EKR9|FADB_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 8 162 9.0E-08
sp|Q0I0T3|FADB_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 8 162 1.0E-07
sp|Q0HPB7|FADB_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 8 162 1.0E-07
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 10 191 1.0E-07
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 23 190 1.0E-07
sp|Q8CPQ4|MENB_STAES 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 10 163 1.0E-07
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 8 162 1.0E-07
sp|Q5HQC3|MENB_STAEQ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 10 162 1.0E-07
sp|A8ALR7|CAID_CITK8 Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 12 160 1.0E-07
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 17 328 1.0E-07
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 49 192 1.0E-07
sp|Q7A6A9|MENB_STAAN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 10 163 2.0E-07
sp|Q99V48|MENB_STAAM 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 10 163 2.0E-07
sp|Q6GI37|MENB_STAAR 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 10 162 2.0E-07
sp|Q5HH38|MENB_STAAC 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 10 162 2.0E-07
sp|Q9D9V3|ECHD1_MOUSE Ethylmalonyl-CoA decarboxylase OS=Mus musculus GN=Echdc1 PE=1 SV=2 11 176 2.0E-07
sp|F1NB38|ECHD1_CHICK Ethylmalonyl-CoA decarboxylase OS=Gallus gallus GN=ECHDC1 PE=3 SV=2 11 264 2.0E-07
sp|Q0TAL0|FADB_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadB PE=3 SV=1 18 328 2.0E-07
sp|Q8DSN0|FABM_STRMU Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 10 202 2.0E-07
sp|Q8FBI2|FADB_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadB PE=3 SV=2 18 328 2.0E-07
sp|B7UNH4|FADB_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadB PE=3 SV=1 15 328 2.0E-07
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 17 328 2.0E-07
sp|Q1R466|FADB_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadB PE=3 SV=2 15 328 2.0E-07
sp|B7MHD1|FADB_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadB PE=3 SV=1 15 328 2.0E-07
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 17 328 2.0E-07
sp|Q32A21|FADB_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadB PE=3 SV=1 18 162 2.0E-07
sp|B7N2F2|FADB_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadB PE=3 SV=1 15 328 3.0E-07
sp|C3LSI3|FADB_VIBCM Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 26 241 3.0E-07
sp|Q9KNI1|FADB_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 26 241 3.0E-07
sp|A5F465|FADB_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 26 241 3.0E-07
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 18 328 3.0E-07
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 18 328 3.0E-07
sp|Q9TM10|MENB_CYACA 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 10 163 3.0E-07
sp|Q83PG1|FADB_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 15 235 3.0E-07
sp|Q0SZ36|FADB_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 15 235 3.0E-07
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 17 235 3.0E-07
sp|B5YY93|FADB_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|Q8X8I2|FADB_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 49 192 3.0E-07
sp|B1LM32|FADB_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B7NV20|FADB_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 15 162 3.0E-07
sp|A8A6V1|FADB_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B2TVJ5|FADB_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B7NFE7|FADB_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 15 162 3.0E-07
sp|B1IW61|FADB_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B7M649|FADB_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B7L9A7|FADB_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|B7LTY9|FADB_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadB PE=3 SV=1 18 162 3.0E-07
sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1 8 155 4.0E-07
sp|Q3YVC1|FADB_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadB PE=3 SV=1 15 162 4.0E-07
sp|P21177|FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadB PE=1 SV=2 15 162 4.0E-07
sp|B1XAK8|FADB_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadB PE=3 SV=1 15 162 4.0E-07
sp|C5A020|FADB_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadB PE=3 SV=1 15 162 4.0E-07
sp|B4TNZ1|FADB_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadB PE=3 SV=1 17 328 4.0E-07
sp|A6TGM4|FADB_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 17 162 5.0E-07
sp|B5RGA4|CAID_SALG2 Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 18 160 5.0E-07
sp|B5R1Q9|CAID_SALEP Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 18 160 5.0E-07
sp|Q8ZRX5|CAID_SALTY Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 18 160 6.0E-07
sp|B4TWR3|CAID_SALSV Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 18 160 6.0E-07
sp|B4TIG9|CAID_SALHS Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 18 160 6.0E-07
sp|A9MYJ5|CAID_SALPB Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 18 160 6.0E-07
sp|B5FHG4|CAID_SALDC Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 18 160 6.0E-07
sp|B5BL54|CAID_SALPK Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|C0Q4L2|CAID_SALPC Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|Q5PIL1|CAID_SALPA Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|Q57TJ1|CAID_SALCH Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|B5F749|CAID_SALA4 Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|Q8Z9L5|CAID_SALTI Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 18 160 7.0E-07
sp|B4T6J5|CAID_SALNS Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 18 160 7.0E-07
sp|B6I4I6|FADB_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadB PE=3 SV=1 18 162 8.0E-07
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 17 162 9.0E-07
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 16 234 9.0E-07
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 8 162 1.0E-06
sp|A7MH81|FADJ_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 28 226 1.0E-06
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 18 162 1.0E-06
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 6 162 1.0E-06
sp|A3Q8U4|FADB_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadB PE=3 SV=1 8 162 1.0E-06
sp|O69762|HCHL_PSEFL Hydroxycinnamoyl-CoA hydratase-lyase OS=Pseudomonas fluorescens PE=1 SV=1 9 203 2.0E-06
sp|Q5E8X6|FADB_VIBF1 Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadB PE=3 SV=1 18 162 2.0E-06
sp|A4WFX4|FADB_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadB PE=3 SV=1 18 162 2.0E-06
sp|B5FEW8|FADB_VIBFM Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain MJ11) GN=fadB PE=3 SV=1 18 162 2.0E-06
sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 23 190 3.0E-06
sp|A7ZU51|FADB_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 15 162 3.0E-06
sp|Q8DDK6|FADB_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadB PE=3 SV=1 13 241 3.0E-06
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 29 162 4.0E-06
sp|Q87TN9|FADB_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadB PE=3 SV=1 13 162 4.0E-06
sp|Q96DC8|ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2 17 155 4.0E-06
sp|B6EGU2|FADB_ALISL Fatty acid oxidation complex subunit alpha OS=Aliivibrio salmonicida (strain LFI1238) GN=fadB PE=3 SV=1 15 234 5.0E-06
sp|Q6LTK3|FADJ_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadJ PE=3 SV=1 51 200 5.0E-06
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 29 162 6.0E-06
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 29 162 6.0E-06
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 29 162 6.0E-06
sp|A8ACZ4|FADB_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadB PE=3 SV=1 18 162 6.0E-06
sp|Q1Q8J9|FADB_PSYCK Fatty acid oxidation complex subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=fadB PE=3 SV=1 51 162 6.0E-06
sp|Q4FQC6|FADB_PSYA2 Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 29 162 6.0E-06
sp|P9WNN5|ECH14_MYCTU Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA14 PE=1 SV=1 10 162 6.0E-06
sp|P9WNN4|ECH14_MYCTO Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA14 PE=3 SV=1 10 162 6.0E-06
sp|P64019|ECH14_MYCBO Probable enoyl-CoA hydratase echA14 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA14 PE=1 SV=1 10 162 6.0E-06
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 20 162 7.0E-06
sp|A7N1D2|FADB_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadB PE=3 SV=1 13 162 7.0E-06
sp|B8CH91|FADB_SHEPW Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 8 197 8.0E-06
sp|Q73VC7|ECH17_MYCPA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=echA17 PE=3 SV=1 16 162 8.0E-06
sp|P9WNN3|ECH17_MYCTU Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA17 PE=1 SV=1 16 162 8.0E-06
sp|P9WNN2|ECH17_MYCTO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA17 PE=3 SV=1 16 162 8.0E-06
sp|A5U753|ECH17_MYCTA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=echA17 PE=3 SV=1 16 162 8.0E-06
sp|A1KN36|ECH17_MYCBP Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=echA17 PE=3 SV=1 16 162 8.0E-06
sp|Q7TXE1|ECH17_MYCBO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA17 PE=1 SV=1 16 162 8.0E-06
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 29 162 8.0E-06
sp|Q39TV7|BAMA_GEOMG 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bamA PE=1 SV=1 21 197 9.0E-06
sp|O87872|BAMA_THAAR 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Thauera aromatica GN=oah PE=1 SV=1 23 195 9.0E-06
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 29 162 9.0E-06
sp|F1R6N4|ECHD1_DANRE Ethylmalonyl-CoA decarboxylase OS=Danio rerio GN=echdc1 PE=3 SV=2 24 166 1.0E-05
sp|A0QJH8|ECH17_MYCA1 Probable enoyl-CoA hydratase echA17 OS=Mycobacterium avium (strain 104) GN=echA17 PE=3 SV=1 16 162 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056110
MSTAASEPTVLFESHSNIRKFILNRPRKLNALDEEMLSLLRPKIEEWSTSDLCGAIIGTGVGKAFCSGGDVASVV
QNASQSSTAHKAVDYFKREFEMDYILAALPKPYVAVLDGITLGGGVGLAANAPFRIATENTVFGMPETKIGYCPD
VGASFFLSRLDGEIGTYLGLTSDTLRGRAVFELGCATHFVPSRRISSLIDQLSAFDTPSLSLIDQAIEELSSERQ
PEDPPTALTRSARMALDYAFRHDKVEDIFRDLETMTKHQDAAIQSFAINTLKKLNSRSPTSLKVALKAIRKGRSM
SLLQALNMEMKMAAAYCHQASPDFVTGVEAVLINKTHKNEGDRPPWAPATLAEVTEDLVDRFFNPTSPFLASTPE
LEIPSSLANTLPNPPSKFALPTEQEIGEVVRGSHSSGGNTGIRLNELVARFQSLRPGKMGVKEKVLEVAARRCGV
EDNADGNTVWLKWKREPTLP*
Coding >AgabiH97|056110
ATGTCCACCGCTGCCTCCGAGCCCACAGTCCTTTTCGAGTCTCACTCGAACATCCGCAAGTTCATTCTCAATCGT
CCCCGTAAGCTCAATGCCCTGGACGAGGAAATGCTTTCTTTGTTGCGCCCTAAAATCGAGGAATGGAGTACGTCC
GACCTCTGCGGTGCGATAATTGGAACCGGCGTCGGCAAGGCGTTTTGTAGTGGAGGCGATGTTGCGAGTGTAGTC
CAGAACGCTTCCCAATCGTCCACCGCTCACAAGGCGGTCGACTATTTTAAGCGCGAGTTTGAGATGGATTACATC
CTGGCTGCCCTACCGAAGCCGTACGTGGCCGTGTTAGATGGGATCACTCTGGGTGGAGGCGTAGGCTTGGCTGCA
AATGCCCCGTTCCGTATTGCAACAGAAAATACCGTCTTTGGCATGCCGGAAACCAAAATTGGCTATTGCCCTGAT
GTTGGTGCAAGTTTTTTCCTATCGCGTTTAGATGGCGAAATAGGAACGTATCTTGGATTGACGTCAGACACCCTA
CGGGGACGCGCAGTATTTGAGCTTGGTTGTGCAACACATTTCGTTCCATCAAGGAGAATCTCGAGCCTTATCGAT
CAATTATCAGCGTTCGATACTCCTAGTCTATCTTTGATTGATCAGGCGATTGAGGAACTGTCTTCGGAGCGCCAG
CCGGAAGATCCGCCTACCGCTTTAACTCGTTCCGCTCGCATGGCTTTAGATTATGCTTTTCGACACGACAAAGTA
GAAGATATTTTTAGGGACCTAGAAACTATGACCAAGCACCAGGATGCTGCTATCCAAAGCTTTGCCATAAACACT
CTGAAGAAGTTAAATTCTCGGAGTCCCACAAGTTTAAAAGTGGCTCTCAAAGCCATCAGAAAGGGCAGGTCAATG
AGTCTCTTACAGGCGCTCAACATGGAAATGAAAATGGCTGCAGCCTATTGCCACCAGGCGAGCCCCGATTTCGTC
ACGGGCGTAGAAGCCGTGCTCATCAACAAAACTCACAAAAACGAGGGCGACCGACCACCTTGGGCCCCGGCAACC
CTGGCTGAGGTTACTGAAGATCTGGTTGATCGTTTTTTCAACCCAACTTCACCCTTTCTTGCTTCGACACCCGAG
TTAGAGATCCCAAGCTCTCTGGCCAACACCTTACCTAATCCTCCATCCAAGTTTGCATTGCCAACCGAGCAGGAA
ATCGGTGAGGTAGTGCGTGGGTCTCACAGCTCGGGTGGCAACACGGGTATTCGTTTGAACGAGCTAGTAGCGAGA
TTCCAAAGTTTGCGACCAGGTAAAATGGGTGTTAAGGAAAAGGTTCTCGAGGTCGCCGCGCGTAGATGCGGCGTC
GAGGACAATGCCGATGGTAATACAGTTTGGCTTAAATGGAAGCGCGAACCTACACTCCCATAG
Transcript >AgabiH97|056110
ATGTCCACCGCTGCCTCCGAGCCCACAGTCCTTTTCGAGTCTCACTCGAACATCCGCAAGTTCATTCTCAATCGT
CCCCGTAAGCTCAATGCCCTGGACGAGGAAATGCTTTCTTTGTTGCGCCCTAAAATCGAGGAATGGAGTACGTCC
GACCTCTGCGGTGCGATAATTGGAACCGGCGTCGGCAAGGCGTTTTGTAGTGGAGGCGATGTTGCGAGTGTAGTC
CAGAACGCTTCCCAATCGTCCACCGCTCACAAGGCGGTCGACTATTTTAAGCGCGAGTTTGAGATGGATTACATC
CTGGCTGCCCTACCGAAGCCGTACGTGGCCGTGTTAGATGGGATCACTCTGGGTGGAGGCGTAGGCTTGGCTGCA
AATGCCCCGTTCCGTATTGCAACAGAAAATACCGTCTTTGGCATGCCGGAAACCAAAATTGGCTATTGCCCTGAT
GTTGGTGCAAGTTTTTTCCTATCGCGTTTAGATGGCGAAATAGGAACGTATCTTGGATTGACGTCAGACACCCTA
CGGGGACGCGCAGTATTTGAGCTTGGTTGTGCAACACATTTCGTTCCATCAAGGAGAATCTCGAGCCTTATCGAT
CAATTATCAGCGTTCGATACTCCTAGTCTATCTTTGATTGATCAGGCGATTGAGGAACTGTCTTCGGAGCGCCAG
CCGGAAGATCCGCCTACCGCTTTAACTCGTTCCGCTCGCATGGCTTTAGATTATGCTTTTCGACACGACAAAGTA
GAAGATATTTTTAGGGACCTAGAAACTATGACCAAGCACCAGGATGCTGCTATCCAAAGCTTTGCCATAAACACT
CTGAAGAAGTTAAATTCTCGGAGTCCCACAAGTTTAAAAGTGGCTCTCAAAGCCATCAGAAAGGGCAGGTCAATG
AGTCTCTTACAGGCGCTCAACATGGAAATGAAAATGGCTGCAGCCTATTGCCACCAGGCGAGCCCCGATTTCGTC
ACGGGCGTAGAAGCCGTGCTCATCAACAAAACTCACAAAAACGAGGGCGACCGACCACCTTGGGCCCCGGCAACC
CTGGCTGAGGTTACTGAAGATCTGGTTGATCGTTTTTTCAACCCAACTTCACCCTTTCTTGCTTCGACACCCGAG
TTAGAGATCCCAAGCTCTCTGGCCAACACCTTACCTAATCCTCCATCCAAGTTTGCATTGCCAACCGAGCAGGAA
ATCGGTGAGGTAGTGCGTGGGTCTCACAGCTCGGGTGGCAACACGGGTATTCGTTTGAACGAGCTAGTAGCGAGA
TTCCAAAGTTTGCGACCAGGTAAAATGGGTGTTAAGGAAAAGGTTCTCGAGGTCGCCGCGCGTAGATGCGGCGTC
GAGGACAATGCCGATGGTAATACAGTTTGGCTTAAATGGAAGCGCGAACCTACACTCCCATAG
Gene >AgabiH97|056110
ATGTCCACCGCTGCCTCCGAGGTCAGTCTCCCTTTTCCCCATGAACAGCACACGTCTCCAACGAAAACAAGCCCA
CAGTCCTTTTCGAGTCTCACTCGAACATCCGCAAGTTCATTCTCAATCGTCCCCGTAAGCTCAATGCCCTGGACG
AGGAAATGCTTTCTTTGTTGCGCCCTAAAATCGAGGCATGCCGGACTTCATGTCTTCTCTCCCCGCTCTTTCTCA
CACGGAGTTCACCAGGAATGGAGTACGTCCGACCTCTGCGGTGCGATAATTGGAACCGGCGTCGGCAAGGCGTTT
TGTAGTGGAGGCGATGTTGCGAGTCAGTGTCACCTTGTCCAATTTGGCATGCTCTGAATTTGTTTTGTAGGTGTA
GTCCAGAACGCTTCCCAATCGTCCACCGCTCACAAGGCGGTCGACTATTTTAAGCGCGAGTACGTGTTTGAGCAT
TCTGCCATCGTTCATCATTGACCGTTGTCCAGGTTTGAGATGGATTACATCCTGGCTGCCCTACCGAAGCCGTAC
GTGGCCGTGTTAGATGGGATCACTCGTAAGTACCAAAATTCGACAGTTGAAGGTATCTGTCTTCTAAAATCCAAA
ACGACAAGTGGGTGGAGGCGTAGGCTTGGCTGCAAATGCCCCGTTCCGTATTGCAACAGAAAATACCGTCTTTGG
CATGCCGGAAACCAAAATTGGCTATTGCCCTGATGTTGGTGCAAGTTTTTTCCTATCGCGTTTAGATGGCGAAAT
AGGAACGTATCTTGGATTGACGTCAGACACCCTACGGGGACGCGCAGTATTGTGAGTCATACCTGACTCTATAAT
CAGGGGTTGAGTCATCGACTCCTTTTTTTTGCAGTGAGCTTGGTTGTGCAACACATTTCGTTCCATCAAGGAGAA
TCTCGAGCCTTATCGATCAATTATCAGCGTTCGATACTCCTAGTCTATCTTTGATTGATCAGGCGATTGAGGAAC
TGTCTTCGGAGCGCCAGCCGGAAGATCCGCCTACCGCTTTAACTCGTTCCGCTCGCATGGCTTTAGATTATGCTT
TTCGACACGACAAAGTAGAAGATATTTTTAGGGACCTAGAAACTATGACCAAGCACCAGGATGCTGCTATCCAAA
GCTTTGCCATAAACACTCTGAAGAAGTTAAATTCTCGGAGTCCCACAAGTTTAAAAGTGGCTCTCAAAGCCATCA
GAAAGGGCAGGTCAATGAGTCTCTTACAGGCGCTCAACATGGAAATGAAAATGGCTGCAGCCTATTGCGTGCGTT
GGTTCTTTTGGTGTCACAGGTCTTTGCTGATTTCGGGTTGATTAGCACCAGGCGAGCCCCGATTTCGTCACGGGC
GTAGAAGCCGTGCTCATCAACAAAACTCACAAAAACGAGGGCGACCGACCACCTTGGGCCCCGGCAACCCTGGCT
GAGGTTACTGAAGATCTGGTTGATCGTTTTTTCAACCCAACTTCACCCTTTCTTGCTTCGACACCCGAGTTAGAG
ATCCCAAGCTCTCTGGCCAACACCTTACCTAATCCTCCATCCAAGTTTGCATTGCCAACCGAGCAGGAAATCGGT
GAGGTAGTGCGTGGGTCTCACAGCTCGGGTGGCAACACGGGTATTCGTTTGAACGAGCTAGTAGCGAGATTCCAA
AGTTTGCGACCAGGTAAAATGGGTGTTAAGGAAAAGGTTCTCGAGGTCGCCGCGCGTAGATGCGGCGTCGAGGAC
AATGCCGATGGTAATACAGTTTGGCTTAAATGGAAGCGCGAACCTACACTCCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail