Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|056050
Gene name
Locationscaffold_3:823353..824860
Strand+
Gene length (bp)1507
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11711 Tim54 Inner membrane protein import complex subunit Tim54 1.7E-58 20 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR90|TIM54_CRYNJ Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM54 PE=3 SV=1 10 476 1.0E-70
sp|P0CR91|TIM54_CRYNB Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM54 PE=3 SV=1 10 476 1.0E-70
sp|P48990|TIM54_CANAL Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM54 PE=3 SV=2 20 340 1.0E-30
sp|Q2UJY4|TIM54_ASPOR Mitochondrial import inner membrane translocase subunit tim54 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tim54 PE=3 SV=1 34 361 2.0E-30
sp|Q6C7Y5|TIM54_YARLI Mitochondrial import inner membrane translocase subunit TIM54 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM54 PE=3 SV=1 7 155 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR90|TIM54_CRYNJ Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM54 PE=3 SV=1 10 476 1.0E-70
sp|P0CR91|TIM54_CRYNB Mitochondrial import inner membrane translocase subunit TIM54 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM54 PE=3 SV=1 10 476 1.0E-70
sp|P48990|TIM54_CANAL Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM54 PE=3 SV=2 20 340 1.0E-30
sp|Q2UJY4|TIM54_ASPOR Mitochondrial import inner membrane translocase subunit tim54 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tim54 PE=3 SV=1 34 361 2.0E-30
sp|Q6C7Y5|TIM54_YARLI Mitochondrial import inner membrane translocase subunit TIM54 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM54 PE=3 SV=1 7 155 5.0E-25
sp|Q9C0Q7|TIM54_NEUCR Mitochondrial import inner membrane translocase subunit tim54 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim54 PE=2 SV=2 36 202 3.0E-23
sp|O94624|TIM54_SCHPO Mitochondrial import inner membrane translocase subunit tim54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim54 PE=3 SV=1 37 353 2.0E-22
sp|Q4WQ82|TIM54_ASPFU Mitochondrial import inner membrane translocase subunit tim54 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim54 PE=3 SV=1 43 349 3.0E-22
sp|Q6FPC0|TIM54_CANGA Mitochondrial import inner membrane translocase subunit TIM54 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM54 PE=3 SV=1 36 333 5.0E-20
sp|Q6BTN1|TIM54_DEBHA Mitochondrial import inner membrane translocase subunit TIM54 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM54 PE=3 SV=2 20 201 2.0E-19
sp|Q758C9|TIM54_ASHGO Mitochondrial import inner membrane translocase subunit TIM54 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM54 PE=3 SV=2 1 353 1.0E-15
sp|P47045|TIM54_YEAST Mitochondrial import inner membrane translocase subunit TIM54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM54 PE=1 SV=1 36 150 2.0E-15
sp|Q6CLP4|TIM54_KLULA Mitochondrial import inner membrane translocase subunit TIM54 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM54 PE=3 SV=1 36 151 1.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|056050
MSEVQNAPVTPKRLSGIRTVFRYTGIPPSWLDKRPKLPSRNWLIFLSVTSSITGYYIYDRQRCKKIRQEYIDKVK
DLAELPSSPLDKPRKVTVYGSKWPGDEDYDQSLRYFRKYVKPILVAAAVDYEMIGSKRLGELANRVANDVRLRRR
LDLGIDQESEATKVLPTYVPLSQARQRELDGGIIVIGRPTWKEFLHGLHRGWTEGLQNIDQDEVLARELEDDGAF
DEPDEPEPVGEGSSEARPGSLMQHKPSLYSPIQLSNILQPQSKSTTVSSSSPGLTNIPPPSEIPPLPPILLVPFT
DYIGLTQIPLMIWGFFNQRQKVQSGAEAAYNVIMKHTRPLRPPSDDSELIESEVPPDSVRGDLDFDKQSDAYLKK
SLNEIPDDIEKARKKYYEELPNRLETARALARGLREPTSDELSNPPLTEVELRQERINKERRWRNDLVGWTIVKP
NTPAVWDNRFRYAIQIFTGPPPSVDGTFNH*
Coding >AgabiH97|056050
ATGTCCGAAGTGCAAAACGCGCCGGTGACGCCTAAAAGACTGTCTGGCATACGAACCGTCTTCAGATACACTGGA
ATACCTCCTTCTTGGCTTGACAAGCGTCCTAAACTTCCCTCGCGCAATTGGCTTATTTTCCTCAGCGTCACTTCA
TCCATCACTGGCTACTATATATATGACCGCCAGCGATGCAAAAAGATACGGCAGGAGTACATAGACAAAGTCAAA
GACCTAGCCGAGTTGCCATCCAGTCCCTTGGATAAACCTCGGAAAGTGACTGTCTACGGCAGCAAGTGGCCTGGC
GATGAAGACTACGACCAAAGTTTGAGGTACTTTAGGAAGTATGTCAAGCCCATTCTTGTTGCAGCTGCTGTGGAT
TATGAGATGATTGGGTCTAAAAGGCTTGGAGAATTAGCAAACCGCGTAGCTAATGACGTTCGACTCCGAAGACGA
CTAGACCTTGGTATCGACCAGGAATCAGAAGCCACCAAAGTCCTTCCAACATATGTCCCACTTTCTCAAGCTCGA
CAACGTGAACTTGACGGTGGAATCATCGTCATCGGACGTCCCACTTGGAAGGAATTTTTACATGGCTTACATCGT
GGTTGGACAGAGGGTTTACAAAACATTGACCAGGATGAAGTTTTAGCCCGAGAGCTGGAAGACGACGGTGCCTTT
GACGAACCTGACGAACCAGAGCCCGTTGGAGAAGGGTCTTCTGAAGCGCGACCTGGATCACTCATGCAACATAAA
CCATCGCTTTATTCACCTATCCAACTCTCCAACATTCTCCAACCACAATCTAAATCTACGACCGTATCCTCGTCC
TCACCCGGGCTTACCAACATCCCCCCGCCATCTGAAATCCCCCCTTTGCCACCAATCCTTCTAGTTCCTTTCACA
GATTATATTGGTCTCACCCAAATACCTCTCATGATCTGGGGCTTTTTCAATCAGCGCCAAAAGGTTCAGTCTGGT
GCCGAGGCTGCTTATAACGTTATCATGAAGCATACCAGACCCCTTCGTCCTCCGTCTGACGATTCAGAATTGATT
GAGTCCGAAGTTCCTCCTGATTCGGTCCGGGGTGACCTGGATTTTGACAAACAGTCAGATGCCTATTTAAAAAAG
TCTTTGAACGAGATACCAGACGATATCGAAAAGGCAAGGAAAAAATACTACGAGGAACTTCCGAATAGGCTAGAA
ACAGCGAGAGCCCTGGCACGCGGCCTACGCGAACCCACAAGCGATGAACTCAGTAATCCTCCTCTCACAGAGGTC
GAGCTCCGCCAAGAAAGAATCAACAAGGAACGTCGATGGCGTAACGATCTTGTTGGGTGGACCATTGTTAAACCT
AATACTCCCGCCGTCTGGGATAATCGCTTCCGCTATGCTATTCAAATATTTACTGGTCCGCCACCTTCCGTGGAC
GGTACATTTAATCATTGA
Transcript >AgabiH97|056050
ATGTCCGAAGTGCAAAACGCGCCGGTGACGCCTAAAAGACTGTCTGGCATACGAACCGTCTTCAGATACACTGGA
ATACCTCCTTCTTGGCTTGACAAGCGTCCTAAACTTCCCTCGCGCAATTGGCTTATTTTCCTCAGCGTCACTTCA
TCCATCACTGGCTACTATATATATGACCGCCAGCGATGCAAAAAGATACGGCAGGAGTACATAGACAAAGTCAAA
GACCTAGCCGAGTTGCCATCCAGTCCCTTGGATAAACCTCGGAAAGTGACTGTCTACGGCAGCAAGTGGCCTGGC
GATGAAGACTACGACCAAAGTTTGAGGTACTTTAGGAAGTATGTCAAGCCCATTCTTGTTGCAGCTGCTGTGGAT
TATGAGATGATTGGGTCTAAAAGGCTTGGAGAATTAGCAAACCGCGTAGCTAATGACGTTCGACTCCGAAGACGA
CTAGACCTTGGTATCGACCAGGAATCAGAAGCCACCAAAGTCCTTCCAACATATGTCCCACTTTCTCAAGCTCGA
CAACGTGAACTTGACGGTGGAATCATCGTCATCGGACGTCCCACTTGGAAGGAATTTTTACATGGCTTACATCGT
GGTTGGACAGAGGGTTTACAAAACATTGACCAGGATGAAGTTTTAGCCCGAGAGCTGGAAGACGACGGTGCCTTT
GACGAACCTGACGAACCAGAGCCCGTTGGAGAAGGGTCTTCTGAAGCGCGACCTGGATCACTCATGCAACATAAA
CCATCGCTTTATTCACCTATCCAACTCTCCAACATTCTCCAACCACAATCTAAATCTACGACCGTATCCTCGTCC
TCACCCGGGCTTACCAACATCCCCCCGCCATCTGAAATCCCCCCTTTGCCACCAATCCTTCTAGTTCCTTTCACA
GATTATATTGGTCTCACCCAAATACCTCTCATGATCTGGGGCTTTTTCAATCAGCGCCAAAAGGTTCAGTCTGGT
GCCGAGGCTGCTTATAACGTTATCATGAAGCATACCAGACCCCTTCGTCCTCCGTCTGACGATTCAGAATTGATT
GAGTCCGAAGTTCCTCCTGATTCGGTCCGGGGTGACCTGGATTTTGACAAACAGTCAGATGCCTATTTAAAAAAG
TCTTTGAACGAGATACCAGACGATATCGAAAAGGCAAGGAAAAAATACTACGAGGAACTTCCGAATAGGCTAGAA
ACAGCGAGAGCCCTGGCACGCGGCCTACGCGAACCCACAAGCGATGAACTCAGTAATCCTCCTCTCACAGAGGTC
GAGCTCCGCCAAGAAAGAATCAACAAGGAACGTCGATGGCGTAACGATCTTGTTGGGTGGACCATTGTTAAACCT
AATACTCCCGCCGTCTGGGATAATCGCTTCCGCTATGCTATTCAAATATTTACTGGTCCGCCACCTTCCGTGGAC
GGTACATTTAATCATTGA
Gene >AgabiH97|056050
ATGTCCGAAGTGCAAAACGCGCCGGTGACGCCTAAAAGACTGTCTGGCATACGAACCGTCTTCAGATACACTGGA
ATACCTCCTTCTTGGCTTGACAAGCGTCCTAAACTTCCCTCGCGCAATTGGCTTATTTTCCTCAGCGTCACTTCA
TCCATCACTGGCTACTATATATATGACCGCCAGCGATGCAAAAAGATACGGCAGGAGTACATAGACAAAGTCAAA
GACCTAGCCGAGTTGCCATCCAGTCCCTTGGATAAACCTCGGAAAGTGACTGTCTACGGCAGCAAGTGGCCTGGC
GATGAAGACTACGACCAAAGTTTGAGGTACTTTAGGAAGTATGTCAAGGTGCGTTTTTTCTTCAGTTGCTTTCAT
GTTATTCCACGTCATAATCAATTATCTTGTGTTTCAGCCCATTCTTGTTGCAGCTGCTGTGGATTATGAGATGAT
TGGGTCTAAAAGGCTTGGAGAATTAGCAAACCGCGTAGCTAATGACGTTCGACTCCGAAGACGACTAGACCTTGG
TATCGACCAGGAATCAGAAGCCACCAAAGTCCTTCCAACATATGTCCCACTTTCTCAAGCTCGACAACGTGAACT
TGACGGTGGAATCATCGTCATCGGACGTCCCACTTGGAAGGAATTTTTACATGGCTTACATCGTGGTTGGACAGA
GGGTTTACAAAACATTGACCAGGATGAAGTTTTAGCCCGAGAGCTGGAAGACGACGGTGCCTTTGACGAACCTGA
CGAACCAGAGCCCGTTGGAGAAGGGTCTTCTGAAGCGCGACCTGGATCACTCATGCAACATAAACCATCGCTTTA
TTCACCTATCCAACTCTCCAACATTCTCCAACCACAATCTAAATCTACGACCGTATCCTCGTCCTCACCCGGGCT
TACCAACATCCCCCCGCCATCTGAAATCCCCCCTTTGCCACCAATCCTTCTAGTTCCTTTCACAGATTATATTGG
TCTCACCCAAATACCTCTCATGATCTGGGGCTTTTTCAATCAGCGCCAAAAGGTTCAGTCTGGTGCCGAGGCTGC
TTATAACGTTATCATGAAGCATACCAGACCCCTTCGTCCTCCGTCTGACGATTCAGAATTGATTGAGTCCGAAGT
TCCTCCTGATTCGGTCCGGGGTGACCTGGATTTTGACAAACAGTCAGATGCCTATTTAAAAAAGTCTTTGAACGA
GATACCAGACGATATCGAAAAGGCAAGGAAAAAATACTACGAGGAACTTCCGAATAGGCTAGAAACAGCGAGAGC
CCTGGCACGCGGCCTACGCGAACCCACAAGCGATGAACTCAGTAATCCTCCTCTCACAGAGGTCGAGCTCCGCCA
AGAAAGAATCAACAAGGAACGTCGATGGCGTAACGATCTTGTTGGGTGGACCATTGTTAAACCTAATACTCCCGC
CGTCTGGGATAATCGCTTCCGCTATGCTATTCAAATATTTACTGGTCCGCCACCTTCCGTGGACGGTACATTTAA
TCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail