Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055980
Gene name
Locationscaffold_3:812920..814297
Strand-
Gene length (bp)1377
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 199 221 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 104.64 61.63 147.64
Initials Initials knots 69.90 41.30 98.50
Pileal_Stipeal_center Stage I stipe center 75.11 43.88 106.34
Pileal_Stipeal_shell Stage I stipe shell 77.24 45.90 108.58
DIF_stipe_center Stage II stipe center 51.83 29.94 73.71
DIF_stipe_shell Stage II stipe shell 70.51 41.59 99.43
DIF_stipe_skin Stage II stipe skin 88.46 52.64 124.28
DIF_cap_skin Stage II cap skin 103.25 61.36 145.14
DIF_cap_tissue Stage II cap tissue 81.28 48.20 114.37
DIF_gill_tissue Stage II gill tissue 66.21 38.72 93.71
YFB_stipe_center Young fruiting body stipe center 69.90 41.31 98.49
YFB_stipe_shell Young fruiting body stipe shell 72.94 43.16 102.73
YFB_stipe_skin Young fruiting body stipe skin 81.89 48.26 115.53
YFB_cap_skin Young fruiting body cap skin 98.86 59.21 138.50
YFB_cap_tissue Young fruiting body cap tissue 84.36 50.25 118.47
YFB_gill_tissue Young fruiting body gill tissue 100.55 59.34 141.76
YFB_veil Young fruiting body veil 90.40 53.83 126.96

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.108850 no
Casing YFB_stipe_center 0.169965 no
Casing YFB_stipe_shell 0.236585 no
Casing YFB_stipe_skin 0.489311 no
Casing YFB_cap_skin 0.910723 no
Casing YFB_cap_tissue 0.561660 no
Casing YFB_gill_tissue 0.940249 no
Casing YFB_veil 0.726746 no
Casing Initials 0.165414 no
Casing Pileal_Stipeal_center 0.292131 no
Casing Pileal_Stipeal_shell 0.346962 no
Casing DIF_stipe_center 0.008791 yes
Casing DIF_stipe_shell 0.179329 no
Casing DIF_stipe_skin 0.676653 no
Casing DIF_cap_skin 0.980367 no
Casing DIF_cap_tissue 0.469242 no
DIF_gill_tissue YFB_stipe_center 0.918550 no
DIF_gill_tissue YFB_stipe_shell 0.839820 no
DIF_gill_tissue YFB_stipe_skin 0.571670 no
DIF_gill_tissue YFB_cap_skin 0.171933 no
DIF_gill_tissue YFB_cap_tissue 0.495953 no
DIF_gill_tissue YFB_gill_tissue 0.155171 no
DIF_gill_tissue YFB_veil 0.342473 no
YFB_stipe_center YFB_stipe_shell 0.936048 no
YFB_stipe_center YFB_stipe_skin 0.699835 no
YFB_stipe_center YFB_cap_skin 0.250684 no
YFB_stipe_center YFB_cap_tissue 0.620710 no
YFB_stipe_center YFB_gill_tissue 0.229585 no
YFB_stipe_center YFB_veil 0.452955 no
YFB_stipe_shell YFB_stipe_skin 0.801465 no
YFB_stipe_shell YFB_cap_skin 0.338043 no
YFB_stipe_shell YFB_cap_tissue 0.730311 no
YFB_stipe_shell YFB_gill_tissue 0.308545 no
YFB_stipe_shell YFB_veil 0.560044 no
YFB_stipe_skin YFB_cap_skin 0.624321 no
YFB_stipe_skin YFB_cap_tissue 0.957445 no
YFB_stipe_skin YFB_gill_tissue 0.587986 no
YFB_stipe_skin YFB_veil 0.835679 no
YFB_cap_skin YFB_cap_tissue 0.687614 no
YFB_cap_skin YFB_gill_tissue 0.974859 no
YFB_cap_skin YFB_veil 0.847821 no
YFB_cap_tissue YFB_gill_tissue 0.661161 no
YFB_cap_tissue YFB_veil 0.892176 no
YFB_gill_tissue YFB_veil 0.816081 no
Initials DIF_gill_tissue 0.919387 no
Initials YFB_stipe_center 0.999427 no
Initials YFB_stipe_shell 0.936575 no
Initials YFB_stipe_skin 0.700196 no
Initials YFB_cap_skin 0.251862 no
Initials YFB_cap_tissue 0.625211 no
Initials YFB_gill_tissue 0.232745 no
Initials YFB_veil 0.453302 no
Initials Pileal_Stipeal_center 0.886011 no
Initials Pileal_Stipeal_shell 0.828893 no
Initials DIF_stipe_center 0.368964 no
Initials DIF_stipe_shell 0.987404 no
Initials DIF_stipe_skin 0.506456 no
Initials DIF_cap_skin 0.189283 no
Initials DIF_cap_tissue 0.719408 no
Pileal_Stipeal_center DIF_gill_tissue 0.785285 no
Pileal_Stipeal_center YFB_stipe_center 0.888452 no
Pileal_Stipeal_center YFB_stipe_shell 0.958477 no
Pileal_Stipeal_center YFB_stipe_skin 0.863203 no
Pileal_Stipeal_center YFB_cap_skin 0.416962 no
Pileal_Stipeal_center YFB_cap_tissue 0.801403 no
Pileal_Stipeal_center YFB_gill_tissue 0.386420 no
Pileal_Stipeal_center YFB_veil 0.643431 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.961047 no
Pileal_Stipeal_center DIF_stipe_center 0.244590 no
Pileal_Stipeal_center DIF_stipe_shell 0.907426 no
Pileal_Stipeal_center DIF_stipe_skin 0.695529 no
Pileal_Stipeal_center DIF_cap_skin 0.330386 no
Pileal_Stipeal_center DIF_cap_tissue 0.877338 no
Pileal_Stipeal_shell DIF_gill_tissue 0.714583 no
Pileal_Stipeal_shell YFB_stipe_center 0.828610 no
Pileal_Stipeal_shell YFB_stipe_shell 0.912403 no
Pileal_Stipeal_shell YFB_stipe_skin 0.912764 no
Pileal_Stipeal_shell YFB_cap_skin 0.476094 no
Pileal_Stipeal_shell YFB_cap_tissue 0.855184 no
Pileal_Stipeal_shell YFB_gill_tissue 0.441504 no
Pileal_Stipeal_shell YFB_veil 0.702496 no
Pileal_Stipeal_shell DIF_stipe_center 0.190735 no
Pileal_Stipeal_shell DIF_stipe_shell 0.853382 no
Pileal_Stipeal_shell DIF_stipe_skin 0.752027 no
Pileal_Stipeal_shell DIF_cap_skin 0.380623 no
Pileal_Stipeal_shell DIF_cap_tissue 0.923568 no
DIF_stipe_center DIF_gill_tissue 0.506269 no
DIF_stipe_center YFB_stipe_center 0.370745 no
DIF_stipe_center YFB_stipe_shell 0.285827 no
DIF_stipe_center YFB_stipe_skin 0.120057 no
DIF_stipe_center YFB_cap_skin 0.013186 yes
DIF_stipe_center YFB_cap_tissue 0.089641 no
DIF_stipe_center YFB_gill_tissue 0.012577 yes
DIF_stipe_center YFB_veil 0.043555 yes
DIF_stipe_center DIF_stipe_shell 0.352257 no
DIF_stipe_center DIF_stipe_skin 0.056760 no
DIF_stipe_center DIF_cap_skin 0.007439 yes
DIF_stipe_center DIF_cap_tissue 0.124109 no
DIF_stipe_shell DIF_gill_tissue 0.901940 no
DIF_stipe_shell YFB_stipe_center 0.987486 no
DIF_stipe_shell YFB_stipe_shell 0.949290 no
DIF_stipe_shell YFB_stipe_skin 0.721293 no
DIF_stipe_shell YFB_cap_skin 0.265846 no
DIF_stipe_shell YFB_cap_tissue 0.643330 no
DIF_stipe_shell YFB_gill_tissue 0.246090 no
DIF_stipe_shell YFB_veil 0.475978 no
DIF_stipe_shell DIF_stipe_skin 0.529943 no
DIF_stipe_shell DIF_cap_skin 0.201152 no
DIF_stipe_shell DIF_cap_tissue 0.737567 no
DIF_stipe_skin DIF_gill_tissue 0.389072 no
DIF_stipe_skin YFB_stipe_center 0.507188 no
DIF_stipe_skin YFB_stipe_shell 0.612139 no
DIF_stipe_skin YFB_stipe_skin 0.876218 no
DIF_stipe_skin YFB_cap_skin 0.803720 no
DIF_stipe_skin YFB_cap_tissue 0.927107 no
DIF_stipe_skin YFB_gill_tissue 0.767304 no
DIF_stipe_skin YFB_veil 0.968647 no
DIF_stipe_skin DIF_cap_skin 0.706894 no
DIF_stipe_skin DIF_cap_tissue 0.862635 no
DIF_cap_skin DIF_gill_tissue 0.127489 no
DIF_cap_skin YFB_stipe_center 0.190009 no
DIF_cap_skin YFB_stipe_shell 0.262684 no
DIF_cap_skin YFB_stipe_skin 0.514137 no
DIF_cap_skin YFB_cap_skin 0.934295 no
DIF_cap_skin YFB_cap_tissue 0.585138 no
DIF_cap_skin YFB_gill_tissue 0.960236 no
DIF_cap_skin YFB_veil 0.757887 no
DIF_cap_skin DIF_cap_tissue 0.499434 no
DIF_cap_tissue DIF_gill_tissue 0.588261 no
DIF_cap_tissue YFB_stipe_center 0.713600 no
DIF_cap_tissue YFB_stipe_shell 0.814616 no
DIF_cap_tissue YFB_stipe_skin 0.988674 no
DIF_cap_tissue YFB_cap_skin 0.601101 no
DIF_cap_tissue YFB_cap_tissue 0.944592 no
DIF_cap_tissue YFB_gill_tissue 0.564582 no
DIF_cap_tissue YFB_veil 0.819112 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055980
MANFFFACFLAAFLPVALCQTISEAICDDGSLNWSFNSVGATPCDVAADLAGVCNGGVFTLASLDEGFSYIGPTQ
LNQNSCRCSTVYYSLLSACAACQGEQWINWTIYKANCSAVYPSVFPQHIPVGTIVPGWAYADIRATDNTFNVTVA
QGLEDRPESTGIASSTRTRGLDSSTSTGTGFPSPSVVDSSGSSSNAGAIAGGVVGGFAGLALIAGLVFFYLRHRR
AAAQQPAYFATPRQPPLDDTMEQKMTQNAYGPSPIPPFQPQRLYDPSDPSTFPTPSPAMSPSYNSGPYTPSPGSA
TFQSSATHVPQHSIPSMSMASPHPAGNYSGAPEL*
Coding >AgabiH97|055980
ATGGCCAACTTCTTCTTTGCCTGCTTTTTGGCCGCATTTCTACCCGTCGCACTTTGCCAGACCATATCAGAAGCC
ATCTGTGATGACGGGTCCTTAAATTGGTCTTTCAATTCTGTGGGAGCTACTCCATGTGATGTTGCTGCTGACTTG
GCAGGCGTATGTAACGGTGGTGTTTTTACTTTGGCGTCTCTTGACGAAGGATTTTCGTATATTGGGCCAACCCAA
CTCAATCAGAACTCATGTCGATGTAGCACTGTATACTATTCCTTGTTGAGTGCTTGTGCCGCTTGCCAGGGAGAG
CAATGGATCAATTGGACAATATACAAAGCAAATTGTTCTGCGGTATACCCTTCAGTGTTTCCTCAACATATCCCA
GTTGGCACGATTGTTCCCGGATGGGCGTACGCTGATATTCGGGCAACTGACAACACTTTCAACGTCACAGTGGCA
CAGGGCCTAGAGGACCGTCCTGAATCTACTGGCATTGCATCGTCTACGCGCACTCGCGGACTTGATTCGTCGACT
TCCACTGGGACTGGTTTCCCCAGCCCTTCTGTGGTTGACAGTTCTGGATCGAGCTCAAATGCTGGCGCTATTGCT
GGAGGCGTCGTCGGTGGCTTCGCTGGTTTGGCGCTGATTGCGGGTCTTGTATTCTTCTACCTCCGTCACCGTCGT
GCAGCCGCCCAACAACCCGCATACTTCGCGACACCTCGTCAGCCCCCCCTCGACGATACAATGGAACAAAAAATG
ACCCAGAATGCTTATGGGCCGAGTCCAATTCCTCCATTTCAACCCCAGAGGCTTTATGACCCCTCCGACCCGAGC
ACTTTTCCGACCCCATCTCCAGCTATGAGTCCCTCCTACAATTCTGGTCCCTATACGCCTTCGCCTGGATCTGCA
ACGTTCCAGAGCTCTGCCACACATGTCCCGCAACACAGCATACCCAGTATGTCCATGGCTTCGCCACACCCCGCA
GGCAACTACAGTGGTGCTCCAGAGCTATAA
Transcript >AgabiH97|055980
ATGGCCAACTTCTTCTTTGCCTGCTTTTTGGCCGCATTTCTACCCGTCGCACTTTGCCAGACCATATCAGAAGCC
ATCTGTGATGACGGGTCCTTAAATTGGTCTTTCAATTCTGTGGGAGCTACTCCATGTGATGTTGCTGCTGACTTG
GCAGGCGTATGTAACGGTGGTGTTTTTACTTTGGCGTCTCTTGACGAAGGATTTTCGTATATTGGGCCAACCCAA
CTCAATCAGAACTCATGTCGATGTAGCACTGTATACTATTCCTTGTTGAGTGCTTGTGCCGCTTGCCAGGGAGAG
CAATGGATCAATTGGACAATATACAAAGCAAATTGTTCTGCGGTATACCCTTCAGTGTTTCCTCAACATATCCCA
GTTGGCACGATTGTTCCCGGATGGGCGTACGCTGATATTCGGGCAACTGACAACACTTTCAACGTCACAGTGGCA
CAGGGCCTAGAGGACCGTCCTGAATCTACTGGCATTGCATCGTCTACGCGCACTCGCGGACTTGATTCGTCGACT
TCCACTGGGACTGGTTTCCCCAGCCCTTCTGTGGTTGACAGTTCTGGATCGAGCTCAAATGCTGGCGCTATTGCT
GGAGGCGTCGTCGGTGGCTTCGCTGGTTTGGCGCTGATTGCGGGTCTTGTATTCTTCTACCTCCGTCACCGTCGT
GCAGCCGCCCAACAACCCGCATACTTCGCGACACCTCGTCAGCCCCCCCTCGACGATACAATGGAACAAAAAATG
ACCCAGAATGCTTATGGGCCGAGTCCAATTCCTCCATTTCAACCCCAGAGGCTTTATGACCCCTCCGACCCGAGC
ACTTTTCCGACCCCATCTCCAGCTATGAGTCCCTCCTACAATTCTGGTCCCTATACGCCTTCGCCTGGATCTGCA
ACGTTCCAGAGCTCTGCCACACATGTCCCGCAACACAGCATACCCAGTATGTCCATGGCTTCGCCACACCCCGCA
GGCAACTACAGTGGTGCTCCAGAGCTATAA
Gene >AgabiH97|055980
ATGGCCAACTTCTTCTTTGCCTGCTTTTTGGCCGCATTTCTACCCGTCGCACTTTGCCAGACCATATCAGAAGCC
ATCTGTGATGACGGGTCCTTAAATTGGGTGCGTGCAAATCCGCCTGCGTCGTTGTGTGTGGATCAAACAACCCTC
CCTTCACCAGTCTTTCAATTCTGTGGGAGCTACTCCATGTGATGTTGCTGCTGACTTGGCAGGCGTATGTAACGG
TGGTGGTGAGTTTCTGCGCTCAGTCAAATACTCTGCGTTAAAAGCTATCACTTTCAAGTTTTTACTTTGGCGTCT
CTTGACGAAGGATTTTCGTATATTGGGCCAACCCAACTCAATCAGAACTCATGTCGATGTAGCACTGTATACTAT
TCCTTGTTGAGTGCTTGTGCCGCTTGCCAGGGAGAGCAATGGATCAAGTAAGTGCTTGCAATCCCCCCCTCCTGT
AAAAGACGGACAGGCTCATGAGACGAAAGTTGGACAATATACAAAGCAAATTGTTCTGCGGTATACCCTTCAGTG
TAAGCAGATTCTCAATGTTGTGCCCATTGTTTTAATCGATTGCCTCAGGTTTCCTCAACATATCCCAGTTGGCAC
GATTGTTCCCGGATGGGCGTACGCTGATATTCGGGTCAGTCGGAGTCTACCCCTAGAGCTGTTCGTTTCACAATC
TGACGTCCCTTCAGGCAACTGACAACACTTTCAACGTCACAGTGGCACAGGGCCTAGAGGGTAAGGACTTTTTCT
ATGTTTCTTCTTTTCCACTGATCGGCTTATAGACCGTCCTGAATCTACTGGCATTGCATCGTCTACGCGCACTCG
CGGACTTGATTCGTCGACTTCCACTGGGACTGGTTTCCCCAGCCCTTCTGTGGTTGACAGTTCTGGATCGAGCTC
AAATGCTGGCGCTATTGCTGGAGGCGTCGTCGGTGGCTTCGCTGGTTTGGCGCTGATTGCGGGTCTTGTATTCTT
CTACCTCCGTCACCGTCGTGCAGCCGCCCAACAACCCGCATACTTCGCGACACCTCGTCAGCCCCCCCTCGACGA
TACAATGGAACAAAAAATGACCCAGAATGCTTATGGGCCGAGTCCAATTCCTCCATTTCAACCCCAGAGGCTTTA
TGTAAGCTGTTTGCTATGCAGTGCTGTTCGACCTGTTACTCAGAATTTTTCTAGGACCCCTCCGACCCGAGCACT
TTTCCGACCCCATCTCCAGCTATGAGTCCCTCCTACAATTCTGGTCCCTATACGCCTTCGCCTGGATCTGCAACG
TTCCAGAGCTCTGCCACACATGTCCCGCAACACAGCATACCCAGTATGTCCATGGCTTCGCCACACCCCGCAGGC
AACTACAGTGGTGCTCCAGAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail