Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055950
Gene name
Locationscaffold_3:807655..809251
Strand-
Gene length (bp)1596
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 6.8E-18 271 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94730|YG0I_SCHPO Uncharacterized protein C1604.18c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.18c PE=3 SV=1 23 442 4.0E-23
sp|Q5ZJB7|CHMP7_CHICK Charged multivesicular body protein 7 OS=Gallus gallus GN=CHMP7 PE=2 SV=1 96 437 9.0E-12
sp|Q8R1T1|CHMP7_MOUSE Charged multivesicular body protein 7 OS=Mus musculus GN=Chmp7 PE=1 SV=1 26 455 3.0E-11
sp|Q5R812|CHMP7_PONAB Charged multivesicular body protein 7 OS=Pongo abelii GN=CHMP7 PE=2 SV=1 26 429 2.0E-10
sp|Q8WUX9|CHMP7_HUMAN Charged multivesicular body protein 7 OS=Homo sapiens GN=CHMP7 PE=1 SV=1 26 429 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94730|YG0I_SCHPO Uncharacterized protein C1604.18c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.18c PE=3 SV=1 23 442 4.0E-23
sp|Q5ZJB7|CHMP7_CHICK Charged multivesicular body protein 7 OS=Gallus gallus GN=CHMP7 PE=2 SV=1 96 437 9.0E-12
sp|Q8R1T1|CHMP7_MOUSE Charged multivesicular body protein 7 OS=Mus musculus GN=Chmp7 PE=1 SV=1 26 455 3.0E-11
sp|Q5R812|CHMP7_PONAB Charged multivesicular body protein 7 OS=Pongo abelii GN=CHMP7 PE=2 SV=1 26 429 2.0E-10
sp|Q8WUX9|CHMP7_HUMAN Charged multivesicular body protein 7 OS=Homo sapiens GN=CHMP7 PE=1 SV=1 26 429 6.0E-10
sp|Q86K93|CHMP7_DICDI Charged multivesicular body protein 7 OS=Dictyostelium discoideum GN=chmp7 PE=3 SV=1 113 424 5.0E-09
sp|P39929|SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF7 PE=1 SV=1 269 397 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055950
MMAAAPGPSADSLSSHSIFQSTSKARLQALYSDFARQKQSNPNAFHANVEWWRKTLEGLLDSGLLRGTVGDSESR
LVLQANRSLLDCVKLDKIGKPLAIGTVINELRSNNTLLLLNEFMSSKVSVYDSGWLPYRIASFVVGRPLWWALEQ
VGIVGDEGILTSSSQTKETVWWGDYVSLPLVEKAADAVMSMQAMRMTGPADTLYTFEGFRRSFGPIFGESSHLLN
DMDARVLVKYLERERKAVILDDQVVKFFDSSVALEDRVITAVDRGILELKSAILNLQHQIDAVQTKMDDYAKKAA
DALRQKRKVLALGFLRSRKQLEDLLGKRLSSLSTLEGTMISIETAAGDVQIMKTFESSTTTLRTILAHSSLQREN
INQTMDALAEASQDAKEVDDAIRIGGDVALGVEISDEEIERELEALAKDVENSPDTLQTLEQLRPPSVLVETTDA
TDKVPLLSH*
Coding >AgabiH97|055950
ATGATGGCAGCGGCACCCGGCCCTTCCGCTGATTCTCTCTCTTCTCACAGTATTTTCCAGAGTACATCTAAGGCT
CGACTCCAGGCTTTATATTCTGATTTCGCCCGCCAGAAGCAATCCAATCCAAACGCTTTTCATGCAAATGTGGAG
TGGTGGCGGAAGACACTGGAAGGCTTACTTGACTCAGGCCTTTTACGTGGCACCGTTGGGGACTCAGAAAGTAGG
CTTGTTCTACAGGCCAATCGCAGTCTTTTGGACTGCGTGAAATTAGACAAGATAGGCAAGCCTCTGGCTATAGGT
ACCGTCATCAATGAATTGCGCTCGAATAATACTCTACTACTTTTGAATGAGTTCATGAGCTCCAAAGTTTCGGTG
TATGACTCCGGCTGGCTCCCGTACCGCATTGCTTCCTTTGTTGTAGGACGTCCTTTGTGGTGGGCACTGGAGCAA
GTTGGGATTGTTGGAGATGAGGGCATTTTGACCTCTAGCTCCCAAACAAAGGAGACAGTCTGGTGGGGAGATTAC
GTATCTCTCCCACTCGTCGAGAAAGCGGCCGATGCAGTCATGTCCATGCAGGCAATGAGAATGACAGGCCCAGCA
GACACTCTGTACACGTTTGAAGGCTTCAGAAGATCATTTGGTCCTATTTTTGGTGAATCAAGCCATCTGCTGAAC
GACATGGACGCTCGAGTTCTCGTCAAGTACCTCGAGAGAGAACGCAAAGCTGTGATTCTCGATGACCAAGTTGTC
AAATTCTTCGATAGCTCAGTGGCACTGGAAGATCGTGTCATCACAGCCGTTGATCGTGGTATTCTTGAATTGAAA
TCTGCAATACTCAACCTTCAGCATCAAATTGATGCAGTTCAGACAAAGATGGACGACTATGCGAAGAAGGCTGCG
GATGCTTTACGACAAAAGCGGAAAGTACTAGCTCTCGGCTTCCTAAGATCACGAAAACAGCTTGAGGACCTTCTA
GGCAAGAGACTTTCTTCTTTGAGTACCTTGGAAGGAACCATGATTTCCATTGAGACGGCAGCTGGCGATGTCCAG
ATAATGAAAACATTCGAATCCTCGACAACTACACTCCGCACTATTCTCGCACACTCCTCACTTCAGCGTGAAAAC
ATCAATCAAACAATGGATGCATTGGCAGAGGCTAGTCAAGATGCCAAGGAGGTCGATGACGCAATAAGAATTGGG
GGTGATGTGGCCCTTGGTGTCGAAATATCTGACGAAGAGATTGAAAGAGAGCTAGAAGCTCTGGCGAAAGATGTC
GAAAATAGTCCGGATACCCTACAGACTCTGGAGCAGCTCCGGCCACCGTCCGTTCTTGTGGAGACAACTGATGCC
ACAGATAAAGTTCCATTACTATCTCATTGA
Transcript >AgabiH97|055950
ATGATGGCAGCGGCACCCGGCCCTTCCGCTGATTCTCTCTCTTCTCACAGTATTTTCCAGAGTACATCTAAGGCT
CGACTCCAGGCTTTATATTCTGATTTCGCCCGCCAGAAGCAATCCAATCCAAACGCTTTTCATGCAAATGTGGAG
TGGTGGCGGAAGACACTGGAAGGCTTACTTGACTCAGGCCTTTTACGTGGCACCGTTGGGGACTCAGAAAGTAGG
CTTGTTCTACAGGCCAATCGCAGTCTTTTGGACTGCGTGAAATTAGACAAGATAGGCAAGCCTCTGGCTATAGGT
ACCGTCATCAATGAATTGCGCTCGAATAATACTCTACTACTTTTGAATGAGTTCATGAGCTCCAAAGTTTCGGTG
TATGACTCCGGCTGGCTCCCGTACCGCATTGCTTCCTTTGTTGTAGGACGTCCTTTGTGGTGGGCACTGGAGCAA
GTTGGGATTGTTGGAGATGAGGGCATTTTGACCTCTAGCTCCCAAACAAAGGAGACAGTCTGGTGGGGAGATTAC
GTATCTCTCCCACTCGTCGAGAAAGCGGCCGATGCAGTCATGTCCATGCAGGCAATGAGAATGACAGGCCCAGCA
GACACTCTGTACACGTTTGAAGGCTTCAGAAGATCATTTGGTCCTATTTTTGGTGAATCAAGCCATCTGCTGAAC
GACATGGACGCTCGAGTTCTCGTCAAGTACCTCGAGAGAGAACGCAAAGCTGTGATTCTCGATGACCAAGTTGTC
AAATTCTTCGATAGCTCAGTGGCACTGGAAGATCGTGTCATCACAGCCGTTGATCGTGGTATTCTTGAATTGAAA
TCTGCAATACTCAACCTTCAGCATCAAATTGATGCAGTTCAGACAAAGATGGACGACTATGCGAAGAAGGCTGCG
GATGCTTTACGACAAAAGCGGAAAGTACTAGCTCTCGGCTTCCTAAGATCACGAAAACAGCTTGAGGACCTTCTA
GGCAAGAGACTTTCTTCTTTGAGTACCTTGGAAGGAACCATGATTTCCATTGAGACGGCAGCTGGCGATGTCCAG
ATAATGAAAACATTCGAATCCTCGACAACTACACTCCGCACTATTCTCGCACACTCCTCACTTCAGCGTGAAAAC
ATCAATCAAACAATGGATGCATTGGCAGAGGCTAGTCAAGATGCCAAGGAGGTCGATGACGCAATAAGAATTGGG
GGTGATGTGGCCCTTGGTGTCGAAATATCTGACGAAGAGATTGAAAGAGAGCTAGAAGCTCTGGCGAAAGATGTC
GAAAATAGTCCGGATACCCTACAGACTCTGGAGCAGCTCCGGCCACCGTCCGTTCTTGTGGAGACAACTGATGCC
ACAGATAAAGTTCCATTACTATCTCATTGA
Gene >AgabiH97|055950
ATGATGGCAGCGGCACCCGGCCCTTCCGCTGATTCTCTCTCTTCTCACAGTATTTTCCAGAGTACATCTAAGGCT
CGACTCCAGGCTTTATATTCTGATTTCGCCCGCCAGAAGCAATCCAATCCAAACGCTTTTCATGCAAATGTGGAG
TGGTGGCGGAAGACACTGGAAGGCTTACTTGACTCAGGCCTTTTACGTGGCACCGTTGGGGACTCAGAAAGTAGG
CTTGTTCTACAGGCCAATCGCAGTCTTTTGGACTGCGTGAAATTAGACAAGATAGGCAAGCCTCTGGCTATAGGT
ACCGTCATCGTGAGTCATTCGAATTCCCCGCAGTGTACGTTGACCTCGGACAAGATTTCATCCTAGCAAGAATGA
ATTGCGCTCGAATAATACTCTACTACTTTTGAATGAGTTCATGAGCTCCAAAGTTTCGGTGTATGACTCCGGCTG
GCTCCCGTACCGCATTGCTTCCTTTGTTGTAGGACGTCCTTTGTGGTGGGCACTGGAGCAAGTTGGGATTGTTGG
AGATGAGGGCATTTTGACCTCTAGCTCCCAAACAAAGGAGACAGTCTGGTGGGGAGATTACGTATCTCTCCCACT
CGTCGAGAAAGCGGCCGATGCAGTCATGTCCATGCAGGCAATGAGAATGACAGGCCCAGCAGACACTCTGTACAC
GTTTGAAGGCTTCAGAAGATCATTTGGTCCTATTTTTGGTGAATCAAGCCATCTGCTGAACGACATGGACGCTCG
AGTTCTCGTCAAGTACCTCGAGAGAGAACGCAAAGCTGTGATTCTCGATGACCAAGTAATTGTGTCACCTTTTCG
CCGAAATTATCCAATCTTTACCTATGGAATAGGTTGTCAAATTCTTCGATAGCTCAGTGGCACTGGAAGATCGTG
TCATCACAGCCGTTGATCGTGGTATTCTTGAATTGAAATCTGCAATACTCAACCTTCAGCATCAAATTGATGCAG
TTCAGACAAAGATGGACGAGTAAGGATTGATTTTTAGGCCGATGTGCGATGCTAACATTGGAGATCTCTAGCTAT
GCGAAGAAGGCTGCGGATGCTTTACGACAAAAGCGGAAAGTACTAGCTCTCGGCTTCCTAAGATCACGAAAACAG
CTTGAGGACCTTCTAGGCAAGAGACTTTCTTCTTTGAGTACCTTGGAAGGAACCATGATTTCCATTGAGACGGCA
GCTGGCGATGTCCAGGCGAGTTCCCTAATGGCGCCCCGTAAATTTTCTAAACTTGGATACTTCCAGATAATGAAA
ACATTCGAATCCTCGACAACTACACTCCGCACTATTCTCGCACACTCCTCACTTCAGCGTGAAAACATCAATCAA
ACAATGGATGCATTGGCAGAGGCTAGTCAAGATGCCAAGGAGGTCGATGACGCAATAAGAATTGGGGGTGATGTG
GCCCTTGGTGTCGAAATATCTGACGAAGAGATTGAAAGAGAGCTAGAAGCTCTGGCGAAAGATGTCGAAAATAGT
CCGGATACCCTACAGACTCTGGAGCAGCTCCGGCCACCGTCCGTTCTTGTGGAGACAACTGATGCCACAGATAAA
GTTCCATTACTATCTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail