Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055910
Gene name
Locationscaffold_3:801218..802917
Strand+
Gene length (bp)1699
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18884 TSP3_bac Bacterial TSP3 repeat 2.5E-05 375 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 2.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 2.0E-178
sp|Q5B297|PLYC_EMENI Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyC PE=3 SV=1 16 417 8.0E-178
sp|Q2UB83|PLYC_ASPOR Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyC PE=3 SV=1 1 417 6.0E-177
sp|O65388|PLY2_ARATH Putative pectate lyase 2 OS=Arabidopsis thaliana GN=At1g11920 PE=3 SV=2 26 237 3.0E-07
sp|O65457|PLY17_ARATH Putative pectate lyase 17 OS=Arabidopsis thaliana GN=At4g22090 PE=3 SV=1 26 174 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 22.24 10.34 34.14
Initials Initials knots 23.17 12.61 33.73
Pileal_Stipeal_center Stage I stipe center 15.45 7.93 22.96
Pileal_Stipeal_shell Stage I stipe shell 16.97 8.59 25.35
DIF_stipe_center Stage II stipe center 13.94 7.04 20.85
DIF_stipe_shell Stage II stipe shell 13.27 6.57 19.97
DIF_stipe_skin Stage II stipe skin 15.36 7.81 22.90
DIF_cap_skin Stage II cap skin 10.74 5.15 16.32
DIF_cap_tissue Stage II cap tissue 9.55 4.61 14.48
DIF_gill_tissue Stage II gill tissue 11.68 5.67 17.70
YFB_stipe_center Young fruiting body stipe center 10.82 5.32 16.33
YFB_stipe_shell Young fruiting body stipe shell 9.94 4.81 15.08
YFB_stipe_skin Young fruiting body stipe skin 16.59 8.53 24.65
YFB_cap_skin Young fruiting body cap skin 13.60 6.80 20.39
YFB_cap_tissue Young fruiting body cap tissue 9.66 4.66 14.65
YFB_gill_tissue Young fruiting body gill tissue 22.59 12.13 33.05
YFB_veil Young fruiting body veil 19.41 10.24 28.58

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.057155 no
Casing YFB_stipe_center 0.031088 yes
Casing YFB_stipe_shell 0.016386 yes
Casing YFB_stipe_skin 0.506577 no
Casing YFB_cap_skin 0.189511 no
Casing YFB_cap_tissue 0.011350 yes
Casing YFB_gill_tissue 0.981897 no
Casing YFB_veil 0.804711 no
Casing Initials 0.950908 no
Casing Pileal_Stipeal_center 0.368237 no
Casing Pileal_Stipeal_shell 0.543543 no
Casing DIF_stipe_center 0.205997 no
Casing DIF_stipe_shell 0.152872 no
Casing DIF_stipe_skin 0.356545 no
Casing DIF_cap_skin 0.034604 yes
Casing DIF_cap_tissue 0.009446 yes
DIF_gill_tissue YFB_stipe_center 0.904332 no
DIF_gill_tissue YFB_stipe_shell 0.766858 no
DIF_gill_tissue YFB_stipe_skin 0.385946 no
DIF_gill_tissue YFB_cap_skin 0.777693 no
DIF_gill_tissue YFB_cap_tissue 0.714583 no
DIF_gill_tissue YFB_gill_tissue 0.035993 yes
DIF_gill_tissue YFB_veil 0.146187 no
YFB_stipe_center YFB_stipe_shell 0.893058 no
YFB_stipe_center YFB_stipe_skin 0.257577 no
YFB_stipe_center YFB_cap_skin 0.631851 no
YFB_stipe_center YFB_cap_tissue 0.850186 no
YFB_stipe_center YFB_gill_tissue 0.018066 yes
YFB_stipe_center YFB_veil 0.080708 no
YFB_stipe_shell YFB_stipe_skin 0.171933 no
YFB_stipe_shell YFB_cap_skin 0.488243 no
YFB_stipe_shell YFB_cap_tissue 0.967887 no
YFB_stipe_shell YFB_gill_tissue 0.011041 yes
YFB_stipe_shell YFB_veil 0.050294 no
YFB_stipe_skin YFB_cap_skin 0.688792 no
YFB_stipe_skin YFB_cap_tissue 0.136741 no
YFB_stipe_skin YFB_gill_tissue 0.446345 no
YFB_stipe_skin YFB_veil 0.762880 no
YFB_cap_skin YFB_cap_tissue 0.428612 no
YFB_cap_skin YFB_gill_tissue 0.140001 no
YFB_cap_skin YFB_veil 0.366549 no
YFB_cap_tissue YFB_gill_tissue 0.008791 yes
YFB_cap_tissue YFB_veil 0.037593 yes
YFB_gill_tissue YFB_veil 0.758355 no
Initials DIF_gill_tissue 0.029648 yes
Initials YFB_stipe_center 0.011659 yes
Initials YFB_stipe_shell 0.008791 yes
Initials YFB_stipe_skin 0.389377 no
Initials YFB_cap_skin 0.120972 no
Initials YFB_cap_tissue 0.005671 yes
Initials YFB_gill_tissue 0.968104 no
Initials YFB_veil 0.707940 no
Initials Pileal_Stipeal_center 0.258826 no
Initials Pileal_Stipeal_shell 0.429603 no
Initials DIF_stipe_center 0.125875 no
Initials DIF_stipe_shell 0.093007 no
Initials DIF_stipe_skin 0.251327 no
Initials DIF_cap_skin 0.018066 yes
Initials DIF_cap_tissue 0.005671 yes
Pileal_Stipeal_center DIF_gill_tissue 0.520010 no
Pileal_Stipeal_center YFB_stipe_center 0.374405 no
Pileal_Stipeal_center YFB_stipe_shell 0.244699 no
Pileal_Stipeal_center YFB_stipe_skin 0.908651 no
Pileal_Stipeal_center YFB_cap_skin 0.818786 no
Pileal_Stipeal_center YFB_cap_tissue 0.213417 no
Pileal_Stipeal_center YFB_gill_tissue 0.300784 no
Pileal_Stipeal_center YFB_veil 0.613438 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.873485 no
Pileal_Stipeal_center DIF_stipe_center 0.859861 no
Pileal_Stipeal_center DIF_stipe_shell 0.776943 no
Pileal_Stipeal_center DIF_stipe_skin 0.992438 no
Pileal_Stipeal_center DIF_cap_skin 0.376462 no
Pileal_Stipeal_center DIF_cap_tissue 0.192412 no
Pileal_Stipeal_shell DIF_gill_tissue 0.328264 no
Pileal_Stipeal_shell YFB_stipe_center 0.219303 no
Pileal_Stipeal_shell YFB_stipe_shell 0.130818 no
Pileal_Stipeal_shell YFB_stipe_skin 0.972299 no
Pileal_Stipeal_shell YFB_cap_skin 0.637149 no
Pileal_Stipeal_shell YFB_cap_tissue 0.107603 no
Pileal_Stipeal_shell YFB_gill_tissue 0.485285 no
Pileal_Stipeal_shell YFB_veil 0.804297 no
Pileal_Stipeal_shell DIF_stipe_center 0.680762 no
Pileal_Stipeal_shell DIF_stipe_shell 0.587521 no
Pileal_Stipeal_shell DIF_stipe_skin 0.865818 no
Pileal_Stipeal_shell DIF_cap_skin 0.224483 no
Pileal_Stipeal_shell DIF_cap_tissue 0.094657 no
DIF_stipe_center DIF_gill_tissue 0.725990 no
DIF_stipe_center YFB_stipe_center 0.573648 no
DIF_stipe_center YFB_stipe_shell 0.418891 no
DIF_stipe_center YFB_stipe_skin 0.735099 no
DIF_stipe_center YFB_cap_skin 0.971478 no
DIF_stipe_center YFB_cap_tissue 0.368624 no
DIF_stipe_center YFB_gill_tissue 0.152734 no
DIF_stipe_center YFB_veil 0.398686 no
DIF_stipe_center DIF_stipe_shell 0.942063 no
DIF_stipe_center DIF_stipe_skin 0.870259 no
DIF_stipe_center DIF_cap_skin 0.568374 no
DIF_stipe_center DIF_cap_tissue 0.342295 no
DIF_stipe_shell DIF_gill_tissue 0.821957 no
DIF_stipe_shell YFB_stipe_center 0.684836 no
DIF_stipe_shell YFB_stipe_shell 0.527131 no
DIF_stipe_shell YFB_stipe_skin 0.643239 no
DIF_stipe_shell YFB_cap_skin 0.972310 no
DIF_stipe_shell YFB_cap_tissue 0.473262 no
DIF_stipe_shell YFB_gill_tissue 0.116118 no
DIF_stipe_shell YFB_veil 0.325777 no
DIF_stipe_shell DIF_stipe_skin 0.789772 no
DIF_stipe_shell DIF_cap_skin 0.676375 no
DIF_stipe_shell DIF_cap_tissue 0.447487 no
DIF_stipe_skin DIF_gill_tissue 0.533921 no
DIF_stipe_skin YFB_stipe_center 0.386027 no
DIF_stipe_skin YFB_stipe_shell 0.256120 no
DIF_stipe_skin YFB_stipe_skin 0.900858 no
DIF_stipe_skin YFB_cap_skin 0.829174 no
DIF_stipe_skin YFB_cap_tissue 0.222255 no
DIF_stipe_skin YFB_gill_tissue 0.295714 no
DIF_stipe_skin YFB_veil 0.601051 no
DIF_stipe_skin DIF_cap_skin 0.387851 no
DIF_stipe_skin DIF_cap_tissue 0.200439 no
DIF_cap_skin DIF_gill_tissue 0.891948 no
DIF_cap_skin YFB_stipe_center 0.990604 no
DIF_cap_skin YFB_stipe_shell 0.909006 no
DIF_cap_skin YFB_stipe_skin 0.256120 no
DIF_cap_skin YFB_cap_skin 0.623881 no
DIF_cap_skin YFB_cap_tissue 0.867782 no
DIF_cap_skin YFB_gill_tissue 0.021583 yes
DIF_cap_skin YFB_veil 0.087251 no
DIF_cap_skin DIF_cap_tissue 0.847224 no
DIF_cap_tissue DIF_gill_tissue 0.693319 no
DIF_cap_tissue YFB_stipe_center 0.831817 no
DIF_cap_tissue YFB_stipe_shell 0.955425 no
DIF_cap_tissue YFB_stipe_skin 0.129100 no
DIF_cap_tissue YFB_cap_skin 0.407590 no
DIF_cap_tissue YFB_cap_tissue 0.987048 no
DIF_cap_tissue YFB_gill_tissue 0.008121 yes
DIF_cap_tissue YFB_veil 0.032978 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055910
MKLSICFASLLYLAGSCSGLLAFPGAEGFGAQATGGRGGSVYVVTNLNDSGSGSFRDAVSESNRIVVFAVGGVIN
ISSRIVVSSHVTIAGQTAPGQGITVYGNGVSYSGADNTITRYIRYRMGRSGDSGKDTITIADGANMIFDHVSVSW
GRDESFSINGDVSNVTISDSIIAQGLETHSCGGLIQTDGGVSIIRTLYIDNKTRNPKVKGVNEFVNNVVYNWGGG
GGYIAGDSAGPSHANIMNNVFISGPSTSVTAFTRGNENFHAYVSNNYYDPDRNGVLSGFILSPTTDNYSPIDFQS
TRYPYPTVKSLLNPLDALHKVASSAGASKSRDSVDNYLINNELLTYGKVGALISDEKASPINGPGNVEGGTPPRD
SDNDGIPDDYETAHGTDPHSNDSARIASNGYANIENYINSLV*
Coding >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCAGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGTGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCGTCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Transcript >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCAGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGTGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCGTCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Gene >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCATGTTACATGAGTCTTTCCCCAACTATCCTCAGCTCCAATTTTGAAATAGGCTTCGGGGCCCAAGC
CACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCTGGGTCTGGCAGCTTTCGCGACGC
GGTTTCAGAATCAAATAGGGTATGTTCAAGGAACTATAGGGATTCGTCTCTCGACGCTAATTCTGTCGGAGATCG
TGGTATTTGCCGTCGGGGGCGTAATCAATATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTC
AAACGGCCCCTGGTCAAGGTATTACTGTATATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTC
GCTATATCCGTTACCGAATGGGAAGGTCAGGTGTGTACATTGTTACGATTCCAGTACACTCCAGTTTTAGTTTAG
ATATAACCTACTAGGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGT
TAGCGTCTCCTGGGGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCAT
CATTGCACAGGGCCTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCAC
TCTGTACATTGATAACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTATGTTT
CTCATTGGAGAGATGTCGTTACTTTGACGATGTGCATATTCTACAGGTTTATAACTGGGGAGGTGGAGGCGGTTA
CATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCCTCGACCTC
AGTCACTGCTTGTAAATGGCGTCTAATCCTTCATTGCACTGCTGCTCACCCGAACCTTTCTTTTTTTATAAAGTC
ACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCTGACAGAGTATGAGGCAATCAT
GAATTGACCAACCAACAAAAGCTGACCGAACTCATAGAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGAC
TGACAACTACTCGCCAATCGATTTCCAATCTACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACT
CGATGCGCTCCATAAGGTCGCGTCATCCGCTGGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAA
CAACGAACTCTTAACCTATGGCAAAGTCGGAGCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGG
AAATGTCGAAGGTGGAACGGTGAGCCGCTTTTTCTCCTCAAAAAACGTATATAAGTAAATGCTGAATATTTTCCC
CAGCCACCTCGGGATAGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCC
AATGACTCTGCAAGGATCGCTTCCAACGGATATGCGAGTAGGGTTTTTGACACATAATGCATTTGTCTACATTTA
CTGACTACTAGCTATAGATATTGAGAACTATATCAACTCTTTGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail