Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055910
Gene name
Locationscaffold_3:801218..802917
Strand+
Gene length (bp)1699
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18884 TSP3_bac Bacterial TSP3 repeat 2.5E-05 375 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 2.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 2.0E-178
sp|Q5B297|PLYC_EMENI Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyC PE=3 SV=1 16 417 8.0E-178
sp|Q2UB83|PLYC_ASPOR Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyC PE=3 SV=1 1 417 6.0E-177
sp|O65388|PLY2_ARATH Putative pectate lyase 2 OS=Arabidopsis thaliana GN=At1g11920 PE=3 SV=2 26 237 3.0E-07
sp|O65457|PLY17_ARATH Putative pectate lyase 17 OS=Arabidopsis thaliana GN=At4g22090 PE=3 SV=1 26 174 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055910
MKLSICFASLLYLAGSCSGLLAFPGAEGFGAQATGGRGGSVYVVTNLNDSGSGSFRDAVSESNRIVVFAVGGVIN
ISSRIVVSSHVTIAGQTAPGQGITVYGNGVSYSGADNTITRYIRYRMGRSGDSGKDTITIADGANMIFDHVSVSW
GRDESFSINGDVSNVTISDSIIAQGLETHSCGGLIQTDGGVSIIRTLYIDNKTRNPKVKGVNEFVNNVVYNWGGG
GGYIAGDSAGPSHANIMNNVFISGPSTSVTAFTRGNENFHAYVSNNYYDPDRNGVLSGFILSPTTDNYSPIDFQS
TRYPYPTVKSLLNPLDALHKVASSAGASKSRDSVDNYLINNELLTYGKVGALISDEKASPINGPGNVEGGTPPRD
SDNDGIPDDYETAHGTDPHSNDSARIASNGYANIENYINSLV*
Coding >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCAGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGTGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCGTCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Transcript >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCAGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGTGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCGTCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Gene >AgabiH97|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGTCTCCTCGCATTTCCAGGA
GCTGAAGGCATGTTACATGAGTCTTTCCCCAACTATCCTCAGCTCCAATTTTGAAATAGGCTTCGGGGCCCAAGC
CACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAATGATTCTGGGTCTGGCAGCTTTCGCGACGC
GGTTTCAGAATCAAATAGGGTATGTTCAAGGAACTATAGGGATTCGTCTCTCGACGCTAATTCTGTCGGAGATCG
TGGTATTTGCCGTCGGGGGCGTAATCAATATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTC
AAACGGCCCCTGGTCAAGGTATTACTGTATATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTC
GCTATATCCGTTACCGAATGGGAAGGTCAGGTGTGTACATTGTTACGATTCCAGTACACTCCAGTTTTAGTTTAG
ATATAACCTACTAGGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGT
TAGCGTCTCCTGGGGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCCGACTCCAT
CATTGCACAGGGCCTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCAC
TCTGTACATTGATAACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTATGTTT
CTCATTGGAGAGATGTCGTTACTTTGACGATGTGCATATTCTACAGGTTTATAACTGGGGAGGTGGAGGCGGTTA
CATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTGTTCATTAGTGGTCCCTCGACCTC
AGTCACTGCTTGTAAATGGCGTCTAATCCTTCATTGCACTGCTGCTCACCCGAACCTTTCTTTTTTTATAAAGTC
ACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAACAATTACTACGATCCTGACAGAGTATGAGGCAATCAT
GAATTGACCAACCAACAAAAGCTGACCGAACTCATAGAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGAC
TGACAACTACTCGCCAATCGATTTCCAATCTACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACT
CGATGCGCTCCATAAGGTCGCGTCATCCGCTGGTGCTAGCAAATCCCGGGACAGCGTCGATAATTATCTCATCAA
CAACGAACTCTTAACCTATGGCAAAGTCGGAGCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGG
AAATGTCGAAGGTGGAACGGTGAGCCGCTTTTTCTCCTCAAAAAACGTATATAAGTAAATGCTGAATATTTTCCC
CAGCCACCTCGGGATAGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCC
AATGACTCTGCAAGGATCGCTTCCAACGGATATGCGAGTAGGGTTTTTGACACATAATGCATTTGTCTACATTTA
CTGACTACTAGCTATAGATATTGAGAACTATATCAACTCTTTGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail