Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055830
Gene name
Locationscaffold_3:780096..781227
Strand+
Gene length (bp)1131
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12589 WBS_methylT Methyltransferase involved in Williams-Beuren syndrome 2.8E-22 202 281
PF08241 Methyltransf_11 Methyltransferase domain 9.6E-10 54 127
PF13649 Methyltransf_25 Methyltransferase domain 1.2E-08 54 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CY21|WBS22_MOUSE Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Mus musculus GN=Wbscr22 PE=1 SV=1 3 284 4.0E-95
sp|P25627|BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 1 284 2.0E-94
sp|Q58DP0|WBS22_BOVIN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Bos taurus GN=WBSCR22 PE=2 SV=1 3 284 1.0E-92
sp|O43709|WBS22_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 3 284 3.0E-92
sp|Q55DA6|WBS22_DICDI Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 1 284 2.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CY21|WBS22_MOUSE Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Mus musculus GN=Wbscr22 PE=1 SV=1 3 284 4.0E-95
sp|P25627|BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 1 284 2.0E-94
sp|Q58DP0|WBS22_BOVIN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Bos taurus GN=WBSCR22 PE=2 SV=1 3 284 1.0E-92
sp|O43709|WBS22_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 3 284 3.0E-92
sp|Q55DA6|WBS22_DICDI Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 1 284 2.0E-91
sp|Q10162|BUD23_SCHPO 18S rRNA (guanine-N(7))-methyltransferase bud23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud23 PE=3 SV=1 1 284 3.0E-88
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 51 122 8.0E-06
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 51 122 8.0E-06
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 51 122 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070476 rRNA (guanine-N7)-methylation Yes
GO:0008168 methyltransferase activity Yes
GO:0016435 rRNA (guanine) methyltransferase activity Yes
GO:0071704 organic substance metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0036265 RNA (guanine-N7)-methylation No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0000154 rRNA modification No
GO:0140098 catalytic activity, acting on RNA No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0031167 rRNA methylation No
GO:0016070 RNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008649 rRNA methyltransferase activity No
GO:0006364 rRNA processing No
GO:0016072 rRNA metabolic process No
GO:0070475 rRNA base methylation No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0001510 RNA methylation No
GO:0016740 transferase activity No
GO:0008173 RNA methyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0009451 RNA modification No
GO:0034660 ncRNA metabolic process No
GO:0032259 methylation No
GO:0043414 macromolecule methylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055830
MSRPELIAPPEIYYGDSEAKKYTQNTRNQQIQADMTYRALELLNLPPEEPAFLLDIGCGSGLSGEILDQEGYAWV
GVDIAPSMLEVALEREVEGDLFLQDIGQGFGFRPGSFDGAISISVLQWLLNAETSHHTSSPPHRLHRFFTTLHSA
LRNPSRAVFQFYPSSDDQIQLITSIAQKAGFGGGIVVDYPNSKKAKKVFLCLFVGGGGGQQEIPKGLEGVEEEGS
KVRFERRRDRERLRGKGGIRKKVKDKDWILKKKELYRRRGKEDVPRDSKYTGRKRKPVF*
Coding >AgabiH97|055830
ATGTCGCGGCCGGAACTCATAGCTCCTCCAGAGATCTACTATGGCGATTCCGAAGCCAAAAAATACACCCAAAAC
ACCCGTAATCAACAGATTCAGGCAGATATGACTTACAGAGCCCTGGAACTACTAAATCTGCCTCCGGAAGAACCT
GCTTTTCTCCTGGACATCGGTTGTGGCTCTGGACTTTCTGGAGAGATCTTGGATCAGGAAGGGTATGCTTGGGTA
GGCGTGGATATTGCACCCAGCATGTTAGAGGTTGCATTAGAGAGGGAAGTCGAGGGAGATCTCTTTCTACAAGAT
ATCGGACAAGGATTTGGCTTTCGACCCGGAAGTTTTGACGGCGCTATAAGTATATCTGTTCTACAATGGCTACTG
AATGCCGAGACTTCGCATCATACATCCTCTCCTCCTCACCGTCTCCATCGTTTTTTCACCACCCTTCACTCCGCT
CTCCGTAATCCCTCTCGCGCAGTTTTCCAATTTTATCCTTCATCGGACGATCAAATCCAACTGATAACGTCTATC
GCACAAAAAGCTGGCTTTGGTGGTGGTATAGTCGTCGATTATCCAAATTCGAAGAAGGCGAAGAAGGTTTTCCTG
TGCCTCTTTGTCGGAGGTGGTGGTGGACAGCAAGAAATACCGAAAGGTTTGGAAGGAGTTGAAGAAGAAGGCAGT
AAAGTGAGGTTCGAAAGGAGGAGGGATAGAGAGAGGTTAAGAGGAAAAGGTGGCATACGGAAGAAAGTCAAGGAC
AAAGACTGGATTCTGAAGAAGAAAGAGCTGTACCGAAGGCGGGGTAAGGAAGATGTACCCAGAGATTCTAAATAC
ACGGGACGAAAACGCAAACCTGTTTTCTAA
Transcript >AgabiH97|055830
ATGTCGCGGCCGGAACTCATAGCTCCTCCAGAGATCTACTATGGCGATTCCGAAGCCAAAAAATACACCCAAAAC
ACCCGTAATCAACAGATTCAGGCAGATATGACTTACAGAGCCCTGGAACTACTAAATCTGCCTCCGGAAGAACCT
GCTTTTCTCCTGGACATCGGTTGTGGCTCTGGACTTTCTGGAGAGATCTTGGATCAGGAAGGGTATGCTTGGGTA
GGCGTGGATATTGCACCCAGCATGTTAGAGGTTGCATTAGAGAGGGAAGTCGAGGGAGATCTCTTTCTACAAGAT
ATCGGACAAGGATTTGGCTTTCGACCCGGAAGTTTTGACGGCGCTATAAGTATATCTGTTCTACAATGGCTACTG
AATGCCGAGACTTCGCATCATACATCCTCTCCTCCTCACCGTCTCCATCGTTTTTTCACCACCCTTCACTCCGCT
CTCCGTAATCCCTCTCGCGCAGTTTTCCAATTTTATCCTTCATCGGACGATCAAATCCAACTGATAACGTCTATC
GCACAAAAAGCTGGCTTTGGTGGTGGTATAGTCGTCGATTATCCAAATTCGAAGAAGGCGAAGAAGGTTTTCCTG
TGCCTCTTTGTCGGAGGTGGTGGTGGACAGCAAGAAATACCGAAAGGTTTGGAAGGAGTTGAAGAAGAAGGCAGT
AAAGTGAGGTTCGAAAGGAGGAGGGATAGAGAGAGGTTAAGAGGAAAAGGTGGCATACGGAAGAAAGTCAAGGAC
AAAGACTGGATTCTGAAGAAGAAAGAGCTGTACCGAAGGCGGGGTAAGGAAGATGTACCCAGAGATTCTAAATAC
ACGGGACGAAAACGCAAACCTGTTTTCTAA
Gene >AgabiH97|055830
ATGTCGCGGCCGGAACTCATAGCTCCTCCAGAGATCGTAAGAGACCCTTTGTTCCCGTCATCCTTATCCTCTAAT
TCATCAGTACCAACATAGTACTATGGCGATTCCGAAGCCAAAAAATACACCCAAAAGTAAGCCGCCAAAAATCTT
TCGTATGGATAAGGTGGTTGATATTGTAAAGCACCCGTAATCAACAGATTCAGGCAGATATGACTTACAGAGCCC
TGGAACTACTAAATCTGCCTCCGGAAGAACCTGCTTTTCTCCTGGACATCGGTTGTGGCTCTGGACTTTCTGGAG
AGATCTTGGATCAGGAAGGGTATGCTTGGGTAGGCGTGGATATTGCACCCAGCATGTTAGGTAGGGCCTGTCTCT
GTTTTCTCTGTTTTCTTTTTGGGTGGAGGTTGAACCATCATAGAGGTTGCATTAGAGAGGGAAGTCGAGGGAGAT
CTCTTTCTACAAGATATCGGACAAGGATTTGGCTTTCGACCCGGAAGTTTTGACGGCGCTATAAGGTACGCCAGT
TTGGCCTCATCCTACTTGGCTCCCTCGAATGAATTCAAATCACCTACAGTATATCTGTTCTACAATGGCTACTGA
ATGCCGAGACTTCGCATCATACATCCTCTCCTCCTCACCGTCTCCATCGTTTTTTCACCACCCTTCACTCCGCTC
TCCGTAATCCCTCTCGCGCAGTTTTCCAATTTTATCCTTCATCGGACGATCAAATCCAACTGATAACGTCTATCG
CACAAAAAGCTGGCTTTGGTGGTGGTATAGTCGTCGATTATCCAAATTCGAAGAAGGCGAAGAAGGTTTTCCTGT
GCCTCTTTGTCGGAGGTGGTGGTGGACAGCAAGAAATACCGAAAGGTTTGGAAGGAGTTGAAGAAGAAGGCAGTA
AAGTGAGGTTCGAAAGGAGGAGGGATAGAGAGAGGTTAAGAGGAAAAGGTGGCATACGGAAGAAAGTCAAGGACA
AAGACTGGATTCTGAAGAAGAAAGAGGTGCGCTTTCATGTGTCAGTAGATTTTCTATGCTCATGTTCCTTTCCCT
CAGCTGTACCGAAGGCGGGGTAAGGAAGATGTACCCAGAGATTCTAAATACACGGGACGAAAACGCAAACCTGTT
TTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail