Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055730
Gene name
Locationscaffold_3:767492..768583
Strand+
Gene length (bp)1091
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 9.7E-50 9 165
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 5.8E-30 9 122
PF00025 Arf ADP-ribosylation factor family 1.1E-10 8 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4E9|GSP1_CANAW GTP-binding nuclear protein GSP1/Ran OS=Candida albicans (strain WO-1) GN=GSP1 PE=3 SV=2 1 211 2.0E-133
sp|P28748|SPI1_SCHPO GTP-binding nuclear protein spi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spi1 PE=1 SV=1 5 211 5.0E-133
sp|Q74ZA9|GSP1_ASHGO GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSP1 PE=3 SV=1 1 211 1.0E-130
sp|P32836|GSP2_YEAST GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP2 PE=1 SV=1 5 211 2.0E-130
sp|P38542|RAN_BRUMA GTP-binding nuclear protein Ran OS=Brugia malayi GN=Bm1_44725 PE=2 SV=2 3 213 8.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4E9|GSP1_CANAW GTP-binding nuclear protein GSP1/Ran OS=Candida albicans (strain WO-1) GN=GSP1 PE=3 SV=2 1 211 2.0E-133
sp|P28748|SPI1_SCHPO GTP-binding nuclear protein spi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spi1 PE=1 SV=1 5 211 5.0E-133
sp|Q74ZA9|GSP1_ASHGO GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSP1 PE=3 SV=1 1 211 1.0E-130
sp|P32836|GSP2_YEAST GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP2 PE=1 SV=1 5 211 2.0E-130
sp|P38542|RAN_BRUMA GTP-binding nuclear protein Ran OS=Brugia malayi GN=Bm1_44725 PE=2 SV=2 3 213 8.0E-126
sp|P52301|RAN_XENLA GTP-binding nuclear protein Ran OS=Xenopus laevis GN=ran PE=1 SV=2 8 213 1.0E-124
sp|Q6FR65|GSP1_CANGA GTP-binding nuclear protein GSP1/Ran OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GSP1 PE=3 SV=1 1 211 1.0E-124
sp|Q6GL85|RAN_XENTR GTP-binding nuclear protein Ran OS=Xenopus tropicalis GN=ran PE=2 SV=1 8 213 7.0E-124
sp|P42558|RAN_CHICK GTP-binding nuclear protein Ran OS=Gallus gallus GN=RAN PE=2 SV=1 8 213 2.0E-123
sp|P32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP1 PE=1 SV=1 5 211 3.0E-123
sp|P62828|RAN_RAT GTP-binding nuclear protein Ran OS=Rattus norvegicus GN=Ran PE=1 SV=3 8 213 1.0E-122
sp|Q5R556|RAN_PONAB GTP-binding nuclear protein Ran OS=Pongo abelii GN=RAN PE=2 SV=3 8 213 1.0E-122
sp|P62827|RAN_MOUSE GTP-binding nuclear protein Ran OS=Mus musculus GN=Ran PE=1 SV=3 8 213 1.0E-122
sp|Q4R4M9|RAN_MACFA GTP-binding nuclear protein Ran OS=Macaca fascicularis GN=RAN PE=2 SV=3 8 213 1.0E-122
sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 8 213 1.0E-122
sp|P62825|RAN_CANLF GTP-binding nuclear protein Ran OS=Canis lupus familiaris GN=RAN PE=1 SV=3 8 213 1.0E-122
sp|Q3T054|RAN_BOVIN GTP-binding nuclear protein Ran OS=Bos taurus GN=RAN PE=2 SV=3 8 213 1.0E-122
sp|P79735|RAN_DANRE GTP-binding nuclear protein Ran OS=Danio rerio GN=ran PE=2 SV=1 8 213 1.0E-122
sp|Q8TFK3|GSP1_YARLI GTP-binding nuclear protein GSP1/Ran OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GSP1 PE=3 SV=1 1 211 2.0E-122
sp|Q9YGC0|RAN_SALSA GTP-binding nuclear protein Ran OS=Salmo salar GN=ran PE=2 SV=1 8 213 2.0E-122
sp|Q7RVL0|GSP1_NEUCR GTP-binding nuclear protein GSP1/Ran OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ran PE=2 SV=1 1 212 6.0E-122
sp|Q9VZ23|RAN_DROME GTP-binding nuclear protein Ran OS=Drosophila melanogaster GN=Ran PE=1 SV=1 5 213 6.0E-122
sp|Q7ZZX9|RAN_CARAU GTP-binding nuclear protein Ran OS=Carassius auratus GN=ran PE=2 SV=1 8 213 2.0E-121
sp|P38544|RAN_ONCVO GTP-binding nuclear protein Ran OS=Onchocerca volvulus GN=ran-1 PE=2 SV=1 3 213 4.0E-121
sp|O17915|RAN_CAEEL GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans GN=ran-1 PE=1 SV=1 3 201 1.0E-120
sp|Q8K586|RANT_RAT GTP-binding nuclear protein Ran, testis-specific isoform OS=Rattus norvegicus GN=Rasl2-9 PE=2 SV=1 8 213 5.0E-117
sp|Q61820|RANT_MOUSE GTP-binding nuclear protein Ran, testis-specific isoform OS=Mus musculus GN=Rasl2-9 PE=2 SV=1 8 213 1.0E-116
sp|P41918|RANA1_TOBAC GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1 6 212 6.0E-114
sp|Q8H156|RAN3_ARATH GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2 6 212 2.0E-113
sp|P38548|RAN_VICFA GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1 6 212 1.0E-112
sp|P41916|RAN1_ARATH GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 6 213 1.0E-112
sp|P41919|RANB1_TOBAC GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1 6 212 3.0E-112
sp|P38546|RAN1_SOLLC GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1 6 212 7.0E-112
sp|P54765|RAN1A_LOTJA GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1 8 207 2.0E-111
sp|P38547|RAN2_SOLLC GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1 6 212 3.0E-111
sp|P33519|RAN_DICDI GTP-binding nuclear protein Ran OS=Dictyostelium discoideum GN=ranA PE=1 SV=1 8 213 8.0E-111
sp|P54766|RAN1B_LOTJA GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1 8 207 1.0E-110
sp|P38545|RAN_PLAFA GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 5 210 4.0E-107
sp|Q7GD79|RAN2_ORYSJ GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1 6 194 7.0E-107
sp|A2Y7R5|RAN2_ORYSI GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1 6 194 7.0E-107
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 6 212 2.0E-105
sp|Q7F7I7|RAN1_ORYSJ GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1 6 194 8.0E-105
sp|A2WSI7|RAN1_ORYSI GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2 6 194 8.0E-105
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 6 212 1.0E-103
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 6 212 1.0E-103
sp|P41914|RAN_TETPY GTP-binding nuclear protein Ran OS=Tetrahymena pyriformis PE=2 SV=1 3 212 6.0E-92
sp|P41915|RAN_TETTH GTP-binding nuclear protein Ran OS=Tetrahymena thermophila PE=2 SV=1 3 212 2.0E-88
sp|Q9VUN3|RANL_DROME GTP-binding nuclear protein Ran-like OS=Drosophila melanogaster GN=Ran-like PE=1 SV=1 8 207 1.0E-83
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 5 177 7.0E-83
sp|P38543|RAN_GIAIN GTP-binding nuclear protein Ran OS=Giardia intestinalis PE=3 SV=1 1 210 1.0E-73
sp|Q8SS11|GSP1_ENCCU GTP-binding nuclear protein GSP1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=GSP1 PE=1 SV=1 7 209 5.0E-51
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 1 170 4.0E-29
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 1 170 4.0E-29
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 1 170 4.0E-29
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 8 163 3.0E-27
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 8 165 5.0E-27
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 8 163 8.0E-27
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 8 163 8.0E-27
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 8 163 8.0E-27
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 8 183 9.0E-27
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 8 163 9.0E-27
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 8 163 9.0E-27
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 8 166 2.0E-26
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 8 166 2.0E-26
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 8 158 2.0E-26
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 8 158 2.0E-26
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 8 158 3.0E-26
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 8 166 4.0E-26
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 8 183 4.0E-26
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 8 184 4.0E-26
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 8 165 4.0E-26
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 8 166 6.0E-26
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 8 193 6.0E-26
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 8 165 6.0E-26
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 8 177 7.0E-26
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 8 177 1.0E-25
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 8 158 1.0E-25
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 8 193 1.0E-25
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 8 158 1.0E-25
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 8 189 2.0E-25
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 8 166 2.0E-25
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 8 166 2.0E-25
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 8 166 2.0E-25
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 3 171 2.0E-25
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 8 158 3.0E-25
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 8 158 3.0E-25
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 8 158 3.0E-25
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 8 166 3.0E-25
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 3 171 3.0E-25
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 3 171 3.0E-25
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 8 165 4.0E-25
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 8 165 4.0E-25
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 8 165 4.0E-25
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 3 171 4.0E-25
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 8 170 4.0E-25
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 8 166 4.0E-25
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 8 165 4.0E-25
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 3 171 5.0E-25
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 8 166 6.0E-25
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 3 178 6.0E-25
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 3 171 7.0E-25
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 8 183 7.0E-25
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 3 177 7.0E-25
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 8 183 7.0E-25
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 1 165 8.0E-25
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 8 190 8.0E-25
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 8 166 9.0E-25
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 8 190 9.0E-25
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 8 190 9.0E-25
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 8 190 9.0E-25
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 8 193 9.0E-25
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 3 177 1.0E-24
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 3 171 1.0E-24
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 8 166 1.0E-24
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 8 165 1.0E-24
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 8 193 1.0E-24
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 3 177 1.0E-24
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 3 177 1.0E-24
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 8 189 1.0E-24
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 8 165 2.0E-24
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 3 168 2.0E-24
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 8 190 2.0E-24
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 8 192 2.0E-24
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 8 168 2.0E-24
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 8 165 2.0E-24
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 8 165 2.0E-24
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 8 165 2.0E-24
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 8 165 2.0E-24
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 8 165 3.0E-24
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 8 165 3.0E-24
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 8 178 3.0E-24
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 8 158 3.0E-24
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 8 183 3.0E-24
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 8 186 4.0E-24
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 8 181 4.0E-24
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 8 177 4.0E-24
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 3 168 5.0E-24
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 8 170 5.0E-24
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 8 186 5.0E-24
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 8 172 5.0E-24
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 8 158 5.0E-24
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 2 165 6.0E-24
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 3 168 6.0E-24
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 3 168 6.0E-24
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 3 168 6.0E-24
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 3 168 6.0E-24
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 8 178 7.0E-24
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 8 168 7.0E-24
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 8 177 7.0E-24
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 3 169 8.0E-24
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 3 168 9.0E-24
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 8 177 1.0E-23
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 3 168 1.0E-23
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 8 186 1.0E-23
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 9 182 1.0E-23
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 5 200 2.0E-23
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 8 171 2.0E-23
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 3 179 2.0E-23
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 8 183 2.0E-23
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 3 165 2.0E-23
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 8 165 2.0E-23
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 8 158 3.0E-23
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 1 169 3.0E-23
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 8 158 3.0E-23
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 8 158 3.0E-23
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 8 158 3.0E-23
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 8 158 3.0E-23
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 8 158 3.0E-23
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 8 158 3.0E-23
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 8 158 3.0E-23
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 8 177 3.0E-23
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 8 159 3.0E-23
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 8 169 3.0E-23
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 9 165 3.0E-23
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 8 187 3.0E-23
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 5 165 3.0E-23
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 5 165 3.0E-23
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 5 165 3.0E-23
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 8 158 4.0E-23
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 8 165 4.0E-23
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 8 158 4.0E-23
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 8 187 4.0E-23
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 8 158 4.0E-23
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 7 165 5.0E-23
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 8 158 5.0E-23
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 8 165 6.0E-23
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 8 172 6.0E-23
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 8 158 6.0E-23
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 8 181 7.0E-23
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 5 171 8.0E-23
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 8 158 1.0E-22
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 9 173 1.0E-22
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 8 166 1.0E-22
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 8 159 1.0E-22
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 7 172 1.0E-22
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 8 170 1.0E-22
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 9 156 1.0E-22
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 8 166 1.0E-22
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 5 171 1.0E-22
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 8 193 1.0E-22
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 7 172 2.0E-22
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 7 172 2.0E-22
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 8 190 2.0E-22
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 8 166 2.0E-22
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 9 187 2.0E-22
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 8 185 2.0E-22
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 7 171 2.0E-22
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 8 177 2.0E-22
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 8 166 2.0E-22
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 4 195 2.0E-22
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 8 166 2.0E-22
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 8 193 2.0E-22
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 8 183 2.0E-22
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 8 177 2.0E-22
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 8 186 2.0E-22
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 8 158 3.0E-22
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 8 158 3.0E-22
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 8 165 3.0E-22
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 8 194 3.0E-22
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 8 158 3.0E-22
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 8 158 3.0E-22
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 9 172 3.0E-22
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 8 165 3.0E-22
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 7 172 3.0E-22
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 8 166 3.0E-22
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 8 193 4.0E-22
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 5 190 4.0E-22
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 8 166 4.0E-22
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 8 166 4.0E-22
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 9 156 4.0E-22
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 8 186 4.0E-22
sp|Q99P74|RB27B_RAT Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 9 157 4.0E-22
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 7 167 5.0E-22
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 8 165 5.0E-22
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 8 165 5.0E-22
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 8 165 5.0E-22
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 8 166 5.0E-22
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 8 166 5.0E-22
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 9 157 5.0E-22
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 8 185 5.0E-22
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 8 165 5.0E-22
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 7 172 5.0E-22
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 8 186 5.0E-22
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 8 176 5.0E-22
sp|E9Q9D5|RBL2A_MOUSE Rab-like protein 2A OS=Mus musculus GN=Rabl2 PE=1 SV=1 3 158 5.0E-22
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 8 166 5.0E-22
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 8 166 5.0E-22
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 7 165 6.0E-22
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 8 166 6.0E-22
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 8 166 6.0E-22
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 8 165 6.0E-22
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 8 165 6.0E-22
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 9 184 6.0E-22
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 8 166 6.0E-22
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 8 166 6.0E-22
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 8 158 7.0E-22
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 8 165 7.0E-22
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 3 177 8.0E-22
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 8 165 8.0E-22
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 9 165 8.0E-22
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 8 183 9.0E-22
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 8 177 9.0E-22
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 4 189 9.0E-22
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 8 183 1.0E-21
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 8 168 1.0E-21
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 8 166 1.0E-21
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 8 166 1.0E-21
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 8 165 1.0E-21
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 8 175 1.0E-21
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 7 193 1.0E-21
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 9 172 1.0E-21
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 8 163 2.0E-21
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 9 165 2.0E-21
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 8 162 2.0E-21
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 8 162 2.0E-21
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 8 162 2.0E-21
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 8 183 2.0E-21
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 8 183 2.0E-21
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 8 177 2.0E-21
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 1 158 2.0E-21
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 8 158 3.0E-21
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 8 158 3.0E-21
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 8 164 3.0E-21
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 8 165 4.0E-21
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 8 158 5.0E-21
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 8 169 6.0E-21
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 8 169 6.0E-21
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 5 190 6.0E-21
sp|Q5R573|RBL2A_PONAB Rab-like protein 2A OS=Pongo abelii GN=RABL2A PE=2 SV=1 3 158 6.0E-21
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 8 168 6.0E-21
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 8 167 6.0E-21
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 8 159 7.0E-21
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 8 158 7.0E-21
sp|Q9UNT1|RBL2B_HUMAN Rab-like protein 2B OS=Homo sapiens GN=RABL2B PE=2 SV=1 3 158 7.0E-21
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 8 183 8.0E-21
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 8 158 8.0E-21
sp|Q9UBK7|RBL2A_HUMAN Rab-like protein 2A OS=Homo sapiens GN=RABL2A PE=1 SV=1 3 158 9.0E-21
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 8 161 9.0E-21
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 8 179 9.0E-21
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 7 173 1.0E-20
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 7 180 1.0E-20
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 8 158 2.0E-20
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 8 173 2.0E-20
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 8 171 2.0E-20
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 8 159 2.0E-20
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 8 165 2.0E-20
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 8 177 2.0E-20
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 8 165 2.0E-20
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 8 159 2.0E-20
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 8 165 2.0E-20
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 8 165 2.0E-20
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 8 165 2.0E-20
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 8 165 2.0E-20
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 8 158 3.0E-20
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 8 165 3.0E-20
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 8 158 3.0E-20
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 8 165 3.0E-20
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 3 171 3.0E-20
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 8 165 3.0E-20
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 9 184 3.0E-20
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 8 189 3.0E-20
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 8 197 3.0E-20
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 8 193 3.0E-20
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 8 170 4.0E-20
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 8 168 4.0E-20
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 8 158 4.0E-20
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 8 158 4.0E-20
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 8 158 4.0E-20
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 8 158 4.0E-20
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 8 158 4.0E-20
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 8 158 4.0E-20
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 8 158 4.0E-20
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 8 158 4.0E-20
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 3 167 5.0E-20
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 8 165 5.0E-20
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 4 165 5.0E-20
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 8 168 6.0E-20
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 8 168 6.0E-20
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 8 168 6.0E-20
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 8 168 6.0E-20
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 8 168 6.0E-20
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 8 168 6.0E-20
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 7 165 6.0E-20
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 8 158 6.0E-20
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 8 165 7.0E-20
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 7 165 7.0E-20
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 8 168 7.0E-20
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 8 171 7.0E-20
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 8 168 7.0E-20
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 8 163 8.0E-20
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 9 153 8.0E-20
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 8 161 8.0E-20
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 9 184 9.0E-20
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 8 163 1.0E-19
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 5 167 1.0E-19
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 8 174 1.0E-19
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 8 165 2.0E-19
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 8 165 2.0E-19
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 9 184 2.0E-19
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 8 165 2.0E-19
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 8 186 2.0E-19
sp|Q54QR3|RB32A_DICDI Ras-related protein Rab-32A OS=Dictyostelium discoideum GN=rab32A PE=1 SV=1 8 168 2.0E-19
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 8 182 2.0E-19
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 8 168 2.0E-19
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 7 165 2.0E-19
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 8 165 2.0E-19
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 1 190 3.0E-19
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 8 167 3.0E-19
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 8 167 3.0E-19
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 8 167 3.0E-19
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 8 165 3.0E-19
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 8 158 3.0E-19
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 8 174 4.0E-19
sp|Q54P07|RB32D_DICDI Ras-related protein Rab-32D OS=Dictyostelium discoideum GN=rab32D PE=3 SV=1 1 166 4.0E-19
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 8 165 5.0E-19
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 14 171 5.0E-19
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 8 183 5.0E-19
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 8 159 5.0E-19
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 9 166 5.0E-19
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 5 190 5.0E-19
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 8 163 6.0E-19
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 9 158 6.0E-19
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 8 177 6.0E-19
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 8 165 6.0E-19
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 8 166 8.0E-19
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 8 167 8.0E-19
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 8 166 9.0E-19
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 5 165 9.0E-19
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 8 201 9.0E-19
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 7 155 9.0E-19
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 8 174 1.0E-18
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 9 166 1.0E-18
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 8 165 1.0E-18
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 8 178 1.0E-18
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 8 177 1.0E-18
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 8 158 2.0E-18
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 8 167 2.0E-18
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 8 158 2.0E-18
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 8 201 2.0E-18
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 8 201 2.0E-18
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 8 177 2.0E-18
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 8 187 2.0E-18
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 8 196 2.0E-18
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 8 196 2.0E-18
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 9 165 2.0E-18
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 8 165 2.0E-18
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 8 177 3.0E-18
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 8 168 3.0E-18
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 8 165 3.0E-18
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 8 165 3.0E-18
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 8 158 3.0E-18
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 8 159 3.0E-18
sp|P57729|RAB38_HUMAN Ras-related protein Rab-38 OS=Homo sapiens GN=RAB38 PE=1 SV=1 8 168 3.0E-18
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 8 163 3.0E-18
sp|Q8QZZ8|RAB38_MOUSE Ras-related protein Rab-38 OS=Mus musculus GN=Rab38 PE=1 SV=1 8 168 3.0E-18
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 8 163 4.0E-18
sp|Q9CZE3|RAB32_MOUSE Ras-related protein Rab-32 OS=Mus musculus GN=Rab32 PE=1 SV=3 8 168 4.0E-18
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 8 179 4.0E-18
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 8 163 4.0E-18
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 8 179 4.0E-18
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 8 165 5.0E-18
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 8 158 5.0E-18
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 8 158 5.0E-18
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 8 158 5.0E-18
sp|Q13637|RAB32_HUMAN Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3 8 168 5.0E-18
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 5 158 6.0E-18
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 8 165 6.0E-18
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 8 165 6.0E-18
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 8 158 6.0E-18
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 8 158 6.0E-18
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 8 165 7.0E-18
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 8 165 7.0E-18
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 8 177 8.0E-18
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 8 158 8.0E-18
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 8 158 1.0E-17
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 5 173 1.0E-17
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 8 158 1.0E-17
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 5 173 1.0E-17
sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 8 165 1.0E-17
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 8 158 1.0E-17
sp|Q55E31|RB32B_DICDI Ras-related protein Rab-32B OS=Dictyostelium discoideum GN=rab32B PE=3 SV=1 8 166 2.0E-17
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 9 125 2.0E-17
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 8 179 3.0E-17
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 9 159 3.0E-17
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 9 173 3.0E-17
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 8 168 3.0E-17
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 9 166 4.0E-17
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 8 165 4.0E-17
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 8 158 7.0E-17
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 7 126 8.0E-17
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 7 126 8.0E-17
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 7 126 8.0E-17
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 8 166 1.0E-16
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 9 167 1.0E-16
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 8 167 2.0E-16
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 8 168 2.0E-16
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 1 170 2.0E-16
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 8 165 2.0E-16
sp|Q06AU5|RAB32_PIG Ras-related protein Rab-32 OS=Sus scrofa GN=RAB32 PE=2 SV=1 8 168 2.0E-16
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 3 165 3.0E-16
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 8 165 3.0E-16
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 8 127 3.0E-16
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 8 165 4.0E-16
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 8 165 4.0E-16
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 8 165 4.0E-16
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 8 165 4.0E-16
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 8 165 4.0E-16
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 3 165 4.0E-16
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 3 165 4.0E-16
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 3 165 4.0E-16
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 8 165 4.0E-16
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 8 165 5.0E-16
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 8 165 5.0E-16
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 8 165 5.0E-16
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 8 165 5.0E-16
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 8 165 5.0E-16
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 8 165 5.0E-16
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 8 165 5.0E-16
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 8 158 5.0E-16
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 1 170 6.0E-16
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 8 165 6.0E-16
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 8 165 6.0E-16
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 8 186 6.0E-16
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 8 165 6.0E-16
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 8 165 6.0E-16
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 8 165 7.0E-16
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 8 158 7.0E-16
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 7 171 1.0E-15
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 8 165 1.0E-15
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 8 165 1.0E-15
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 8 165 1.0E-15
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 8 158 1.0E-15
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 9 162 1.0E-15
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 8 170 2.0E-15
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 4 165 2.0E-15
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 4 165 2.0E-15
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 7 127 2.0E-15
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 4 165 2.0E-15
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 8 127 2.0E-15
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 8 127 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055730
MTDTIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFTTNFGNICFNVWDTAGQEKFGGLRDG
YYIQGQCGIIMFDVTSRITYKNVPNWHRDLERVCENIPIVLCGNKIDVKERKVKTGAVTFHRKKNLQYFEISAKS
NYNFEKPFLWLAQKLVGNPRLEFVAAPALAPAEVAIDANLMKQYEQELKQAEAVPLPEEEDDL*
Coding >AgabiH97|055730
ATGACTGACACTATCCCTACTTTCAAACTCGTCCTCGTCGGCGACGGTGGTACCGGCAAGACTACCTTTGTCAAG
CGCCACTTGACTGGTGAATTTGAGAAAAAATACATTGCCACCCTTGGTGTCGAAGTTCACCCTCTGCACTTCACA
ACCAACTTCGGCAACATCTGTTTCAACGTCTGGGATACAGCGGGACAGGAAAAGTTCGGCGGTTTGAGGGATGGT
TATTACATCCAAGGTCAATGTGGAATCATTATGTTTGATGTCACCTCGCGAATCACCTACAAAAACGTCCCCAAT
TGGCATCGCGATCTCGAGCGTGTCTGTGAAAACATCCCCATTGTCCTTTGTGGTAACAAAATCGATGTGAAGGAA
CGCAAAGTGAAGACCGGCGCTGTTACCTTCCACCGCAAGAAGAACTTGCAGTATTTCGAAATCTCTGCAAAGTCG
AACTATAACTTTGAAAAACCCTTCCTGTGGCTCGCACAGAAACTCGTCGGTAATCCCCGTCTTGAATTTGTTGCC
GCCCCAGCCCTTGCTCCCGCCGAAGTTGCCATAGATGCCAATCTCATGAAGCAGTATGAGCAAGAACTCAAACAG
GCGGAAGCTGTTCCTCTTCCTGAGGAAGAAGACGATCTCTAA
Transcript >AgabiH97|055730
ATGACTGACACTATCCCTACTTTCAAACTCGTCCTCGTCGGCGACGGTGGTACCGGCAAGACTACCTTTGTCAAG
CGCCACTTGACTGGTGAATTTGAGAAAAAATACATTGCCACCCTTGGTGTCGAAGTTCACCCTCTGCACTTCACA
ACCAACTTCGGCAACATCTGTTTCAACGTCTGGGATACAGCGGGACAGGAAAAGTTCGGCGGTTTGAGGGATGGT
TATTACATCCAAGGTCAATGTGGAATCATTATGTTTGATGTCACCTCGCGAATCACCTACAAAAACGTCCCCAAT
TGGCATCGCGATCTCGAGCGTGTCTGTGAAAACATCCCCATTGTCCTTTGTGGTAACAAAATCGATGTGAAGGAA
CGCAAAGTGAAGACCGGCGCTGTTACCTTCCACCGCAAGAAGAACTTGCAGTATTTCGAAATCTCTGCAAAGTCG
AACTATAACTTTGAAAAACCCTTCCTGTGGCTCGCACAGAAACTCGTCGGTAATCCCCGTCTTGAATTTGTTGCC
GCCCCAGCCCTTGCTCCCGCCGAAGTTGCCATAGATGCCAATCTCATGAAGCAGTATGAGCAAGAACTCAAACAG
GCGGAAGCTGTTCCTCTTCCTGAGGAAGAAGACGATCTCTAA
Gene >AgabiH97|055730
ATGACTGACACTATCCCTACTTTCAAACTCGTCCTCGGTAAGCTCTTTGTCCCATAATGCTGCTTCAACACAAAC
TCATTTACAATTCAACCTAATCTTCACTCCATCTTCATCGATCGTCCGCCACTCTGTGACGACGTGCTCCTCCCA
TTTCTGGTTCATCAAACTCGCCTCCTTCAATACGTTTGATCCCTAATCGCGTAGTCGGCGACGGTGGTACCGGCA
AGACTACCTTTGTCAAGGTAGGCGACAGCTTCATGCATCAACCGATCGTATGCTGATCCCTCTGGGTCTATAGCG
CCACTTGACTGGTGAATTTGAGAAAAAATACATTGGTATGAACAGGGCGCCCGTGTTTAGCATCGCATTTGCATT
GATTTTACTTCATTTTGATTAGCCACCCTTGGTGTCGAAGTTCACCCTCTGCACTTCACAACCAACTTCGGCAAC
ATCTGTTTCAACGTCTGGGATACAGCGGGACAGGAAAAGTTCGGCGGTTTGAGGGATGGTTATTACATCCAAGGT
CAATGTGGAATCATTATGTTTGATGTCACCTCGCGAATCACCTACAAAAACGTCCCCAATTGGCATCGCGATCTC
GAGCGTGTCTGTGAAAACATCCCCATTGTCCTTTGTGGTAACAAAATCGATGTGAAGGTAAGGTCGGCTCGTAGT
GAAGATTTTTCACCATTCACTCCTCTGATTGTGCTCAACAGGAACGCAAAGTGAAGACCGGCGCTGTTACCTTCC
ACCGCAAGAAGAACTTGCAGTATTTCGAAATCTCTGCAAAGTCGAACTATAACTTTGAAAAACCCTTCCTGTGGC
TCGCACAGAAACTCGTCGGGTAAGAACGGGTACACCACACGGCTTACGAGCTATACTCACATGTCGTGACCAGTA
ATCCCCGTCTTGAATTTGTTGCCGCCCCAGCCCTTGCTCCCGCCGAAGTTGCCATAGATGCCAATCTCATGAAGC
AGTATGAGCAAGAACTCAAACAGGTGAGTAGCCTCAGGAATCTAAGCTGCTTCATTTGATGAACCTGCTTTCAGG
CGGAAGCTGTTCCTCTTCCTGAGGAAGAAGACGATCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail