Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055710
Gene name
Locationscaffold_3:757296..761872
Strand-
Gene length (bp)4576
Transcript length (bp)3108
Coding sequence length (bp)3108
Protein length (aa) 1036

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 5.7E-26 601 821
PF00743 FMO-like Flavin-binding monooxygenase-like 3.4E-18 63 406
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.7E-12 66 132
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.2E-12 603 831
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 5.9E-09 63 250
PF17667 Pkinase_fungal Fungal protein kinase 1.4E-08 698 799
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 7.5E-07 147 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 595 942 1.0E-175
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 592 1035 1.0E-173
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 591 972 4.0E-159
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 594 894 2.0E-148
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 594 894 3.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 595 942 1.0E-175
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 592 1035 1.0E-173
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 591 972 4.0E-159
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 594 894 2.0E-148
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 594 894 3.0E-148
sp|P23291|KC11_YEAST Casein kinase I homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK1 PE=1 SV=1 594 894 9.0E-147
sp|P39962|KC13_YEAST Casein kinase I homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK3 PE=1 SV=2 586 933 2.0E-134
sp|Q8C4X2|KC1G3_MOUSE Casein kinase I isoform gamma-3 OS=Mus musculus GN=Csnk1g3 PE=1 SV=2 596 884 3.0E-122
sp|Q62763|KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus GN=Csnk1g3 PE=1 SV=1 596 884 3.0E-122
sp|Q5R4V3|KC1G3_PONAB Casein kinase I isoform gamma-3 OS=Pongo abelii GN=CSNK1G3 PE=2 SV=1 596 884 3.0E-121
sp|P78368|KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens GN=CSNK1G2 PE=1 SV=1 596 884 6.0E-121
sp|Q5PRD4|KC1G1_DANRE Casein kinase I isoform gamma-1 OS=Danio rerio GN=csnk1g1 PE=2 SV=1 596 970 2.0E-120
sp|Q8BVP5|KC1G2_MOUSE Casein kinase I isoform gamma-2 OS=Mus musculus GN=Csnk1g2 PE=1 SV=1 596 884 4.0E-120
sp|Q62762|KC1G2_RAT Casein kinase I isoform gamma-2 OS=Rattus norvegicus GN=Csnk1g2 PE=2 SV=2 596 884 5.0E-120
sp|Q9Y6M4|KC1G3_HUMAN Casein kinase I isoform gamma-3 OS=Homo sapiens GN=CSNK1G3 PE=1 SV=2 596 884 1.0E-119
sp|Q4R9A9|KC1G1_MACFA Casein kinase I isoform gamma-1 OS=Macaca fascicularis GN=CSNK1G1 PE=2 SV=1 596 930 2.0E-118
sp|Q62761|KC1G1_RAT Casein kinase I isoform gamma-1 OS=Rattus norvegicus GN=Csnk1g1 PE=2 SV=1 596 930 4.0E-118
sp|Q8BTH8|KC1G1_MOUSE Casein kinase I isoform gamma-1 OS=Mus musculus GN=Csnk1g1 PE=1 SV=2 596 941 5.0E-118
sp|Q9HCP0|KC1G1_HUMAN Casein kinase I isoform gamma-1 OS=Homo sapiens GN=CSNK1G1 PE=1 SV=1 596 930 8.0E-118
sp|Q5ZJS0|KC1G1_CHICK Casein kinase I isoform gamma-1 OS=Gallus gallus GN=CSNK1G1 PE=2 SV=1 596 884 2.0E-117
sp|Q6NRT0|KC1G1_XENLA Casein kinase I isoform gamma-1 OS=Xenopus laevis GN=csnk1g1 PE=1 SV=1 596 884 3.0E-117
sp|A7E3X2|KC1G1_BOVIN Casein kinase I isoform gamma-1 OS=Bos taurus GN=CSNK1G1 PE=2 SV=1 596 884 8.0E-117
sp|Q6QNM1|KC1_TOXGO Casein kinase I OS=Toxoplasma gondii PE=2 SV=1 597 900 3.0E-116
sp|Q8WQ99|KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans GN=csnk-1 PE=3 SV=1 587 884 7.0E-116
sp|Q5BP74|KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2 597 890 1.0E-114
sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 597 935 2.0E-114
sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 597 935 2.0E-114
sp|Q5ZLL1|KC1E_CHICK Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2 597 960 2.0E-114
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 597 935 2.0E-114
sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 597 935 2.0E-114
sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 597 935 4.0E-114
sp|Q9JMK2|KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2 597 890 4.0E-114
sp|Q6P647|KC1D_XENTR Casein kinase I isoform delta OS=Xenopus tropicalis GN=csnk1d PE=2 SV=1 597 890 5.0E-114
sp|P67963|KC1A_XENLA Casein kinase I isoform alpha OS=Xenopus laevis GN=csnk1a1 PE=2 SV=1 596 899 6.0E-114
sp|P67962|KC1A_CHICK Casein kinase I isoform alpha OS=Gallus gallus GN=CSNK1A1 PE=2 SV=1 596 899 6.0E-114
sp|Q8BK63|KC1A_MOUSE Casein kinase I isoform alpha OS=Mus musculus GN=Csnk1a1 PE=1 SV=2 596 899 7.0E-114
sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens GN=CSNK1A1 PE=1 SV=2 596 899 7.0E-114
sp|P49674|KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1 597 890 7.0E-114
sp|P67829|KC1A_SHEEP Casein kinase I isoform alpha OS=Ovis aries GN=CSNK1A1 PE=3 SV=1 596 899 8.0E-114
sp|P67828|KC1A_RABIT Casein kinase I isoform alpha OS=Oryctolagus cuniculus GN=CSNK1A1 PE=1 SV=1 596 899 8.0E-114
sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus GN=CSNK1A1 PE=1 SV=1 596 899 8.0E-114
sp|Q7T2E3|KC1DA_DANRE Casein kinase I isoform delta-A OS=Danio rerio GN=csnk1da PE=2 SV=1 597 890 1.0E-113
sp|Q6P3K7|KC1DB_DANRE Casein kinase I isoform delta-B OS=Danio rerio GN=csnk1db PE=2 SV=1 597 890 5.0E-113
sp|P97633|KC1A_RAT Casein kinase I isoform alpha OS=Rattus norvegicus GN=Csnk1a1 PE=2 SV=1 596 899 1.0E-112
sp|P40235|HHP1_SCHPO Casein kinase I homolog hhp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp1 PE=2 SV=1 597 886 4.0E-111
sp|Q6QNL9|KC1_EIMTE Casein kinase I OS=Eimeria tenella PE=2 SV=1 597 888 1.0E-110
sp|Q8N752|KC1AL_HUMAN Casein kinase I isoform alpha-like OS=Homo sapiens GN=CSNK1A1L PE=2 SV=2 586 889 2.0E-110
sp|P42168|KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans GN=kin-19 PE=3 SV=1 596 905 5.0E-110
sp|P42158|KC1D_ARATH Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2 597 897 7.0E-109
sp|P35509|KC1G3_BOVIN Casein kinase I isoform gamma-3 (Fragment) OS=Bos taurus GN=CSNK1G3 PE=2 SV=1 596 849 3.0E-108
sp|Q556Y4|KC1_DICDI Casein kinase I OS=Dictyostelium discoideum GN=cak1-1 PE=1 SV=1 597 891 1.0E-107
sp|Q20471|KIN20_CAEEL Casein kinase I isoform delta OS=Caenorhabditis elegans GN=kin-20 PE=2 SV=3 582 885 3.0E-106
sp|P54367|KC1A_DROME Casein kinase I isoform alpha OS=Drosophila melanogaster GN=CkIalpha PE=1 SV=1 596 916 2.0E-105
sp|O76324|DCO_DROME Discs overgrown protein kinase OS=Drosophila melanogaster GN=dco PE=1 SV=2 597 914 3.0E-105
sp|P40236|HHP2_SCHPO Casein kinase I homolog hhp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp2 PE=2 SV=2 597 887 1.0E-103
sp|P29295|HRR25_YEAST Casein kinase I homolog HRR25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRR25 PE=1 SV=1 597 887 1.0E-102
sp|Q8IHZ9|KC1_PLAF7 Casein kinase I OS=Plasmodium falciparum (isolate 3D7) GN=CK1 PE=3 SV=1 597 885 2.0E-102
sp|Q7RBX5|KC1_PLAYO Casein kinase I OS=Plasmodium yoelii yoelii GN=CK1 PE=3 SV=1 597 885 2.0E-102
sp|O15726|KC1_PLAF4 Casein kinase I OS=Plasmodium falciparum (isolate Dd2) GN=CK1 PE=2 SV=1 597 922 3.0E-100
sp|P35507|KC1B_BOVIN Casein kinase I isoform beta OS=Bos taurus GN=CSNK1B PE=2 SV=1 587 926 2.0E-99
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 50 513 8.0E-88
sp|Q8SS96|KC11_ENCCU Probable casein kinase I homolog ECU03_0910 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_0910 PE=3 SV=2 602 884 6.0E-78
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 64 513 3.0E-76
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 33 497 1.0E-70
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 60 512 5.0E-61
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 60 512 5.0E-61
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 60 512 5.0E-61
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 64 502 2.0E-52
sp|Q54DF7|Y2354_DICDI Probable serine/threonine-protein kinase DDB_G0292354 OS=Dictyostelium discoideum GN=DDB_G0292354 PE=3 SV=1 595 886 3.0E-44
sp|Q00730|STCW_EMENI Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcW PE=3 SV=2 58 508 8.0E-44
sp|Q8SQR2|KC12_ENCCU Probable casein kinase I homolog ECU11_1980 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1980 PE=3 SV=1 601 877 4.0E-43
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 66 496 1.0E-41
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 50 501 2.0E-39
sp|O19175|KC1A_PIG Casein kinase I isoform alpha (Fragment) OS=Sus scrofa GN=CSNK1A1 PE=2 SV=1 625 750 1.0E-37
sp|Q5TCY1|TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens GN=TTBK1 PE=1 SV=2 596 940 1.0E-36
sp|Q6PCN3|TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus GN=Ttbk1 PE=1 SV=3 596 922 2.0E-36
sp|Q6IQ55|TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1 SV=2 596 884 5.0E-36
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 66 510 1.0E-35
sp|Q3UVR3|TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus GN=Ttbk2 PE=1 SV=1 596 884 1.0E-34
sp|E3VWK3|PENE_STREX Pentalenolactone D synthase OS=Streptomyces exfoliatus GN=penE PE=1 SV=1 56 505 5.0E-34
sp|A1CLY7|CCSB_ASPCL Ketocytochalasin monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsB PE=1 SV=1 47 451 8.0E-34
sp|U5S003|BVMO4_DIESD Baeyer-Villiger monooxygenase 4 OS=Dietzia sp. (strain D5) PE=1 SV=1 83 510 2.0E-33
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 53 452 1.0E-32
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 66 496 3.0E-31
sp|P81123|KC1D_RABIT Casein kinase I isoform delta (Fragment) OS=Oryctolagus cuniculus GN=CSNK1D PE=1 SV=1 721 800 5.0E-31
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 59 505 2.0E-30
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 64 450 6.0E-29
sp|Q32PI1|VRK1_BOVIN Serine/threonine-protein kinase VRK1 OS=Bos taurus GN=VRK1 PE=2 SV=1 601 890 1.0E-28
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 64 450 1.0E-28
sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens GN=VRK1 PE=1 SV=1 594 890 1.0E-27
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 57 497 2.0E-27
sp|Q80X41|VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus GN=Vrk1 PE=1 SV=2 601 890 2.0E-27
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 64 450 1.0E-26
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 64 450 1.0E-26
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 64 450 1.0E-26
sp|Q9RL17|BVMO1_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0300 PE=1 SV=1 82 455 5.0E-26
sp|Q95PZ9|SPE6_CAEEL Probable serine/threonine-protein kinase spe-6 OS=Caenorhabditis elegans GN=spe-6 PE=1 SV=1 601 884 4.0E-24
sp|Q82IY8|PTLE_STRAW Neopentalenolactone D synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlE PE=1 SV=1 56 505 6.0E-24
sp|Q7ZUS1|VRK1_DANRE Serine/threonine-protein kinase VRK1 OS=Danio rerio GN=vrk1 PE=2 SV=1 601 926 7.0E-22
sp|P34516|YMX8_CAEEL Putative serine/threonine-protein kinase K06H7.1 OS=Caenorhabditis elegans GN=K06H7.8 PE=3 SV=2 582 872 2.0E-21
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 64 410 2.0E-19
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 64 410 2.0E-19
sp|Q9J523|V212_FOWPN Probable serine/threonine-protein kinase FPV212 OS=Fowlpox virus (strain NVSL) GN=FPV212 PE=3 SV=1 579 868 4.0E-19
sp|Q7KRY6|NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster GN=ball PE=1 SV=1 595 878 6.0E-19
sp|O57252|VPK1_VACCA Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Ankara) GN=VPK1 PE=3 SV=1 603 869 9.0E-19
sp|P16913|VPK1_VACCW Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Western Reserve) GN=VPK1 PE=1 SV=1 603 869 1.0E-18
sp|Q8BN21|VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus GN=Vrk2 PE=1 SV=2 582 969 1.0E-18
sp|P20505|VPK1_VACCC Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Copenhagen) GN=VPK1 PE=2 SV=1 603 869 1.0E-18
sp|P33800|VPK1_VAR67 Serine/threonine-protein kinase 1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B1R PE=3 SV=1 603 869 3.0E-18
sp|P21098|KRB2_VACCC Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Copenhagen) GN=B12R PE=3 SV=1 656 869 4.0E-18
sp|P42169|YKL2_CAEEL Putative casein kinase I C03C10.2 OS=Caenorhabditis elegans GN=C03C10.2 PE=3 SV=2 607 872 5.0E-18
sp|O57259|KRB2_VACCA Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Ankara) GN=MVA180R PE=3 SV=1 656 869 1.0E-17
sp|Q09503|YQI1_CAEEL Uncharacterized protein C45G9.1 OS=Caenorhabditis elegans GN=C45G9.1 PE=3 SV=2 657 884 4.0E-17
sp|P24362|KRB2_VACCW Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Western Reserve) GN=VACWR194 PE=2 SV=1 656 869 8.0E-17
sp|Q91FD5|389L_IIV6 Probable serine/threonine-protein kinase 389L OS=Invertebrate iridescent virus 6 GN=IIV6-389L PE=3 SV=1 593 867 4.0E-16
sp|Q86Y07|VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens GN=VRK2 PE=1 SV=3 582 867 2.0E-15
sp|P34633|YOO1_CAEEL Putative serine/threonine-protein kinase ZK507.1 OS=Caenorhabditis elegans GN=ZK507.1 PE=3 SV=3 659 865 3.0E-15
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 61 406 2.0E-13
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 64 406 4.0E-13
sp|Q9J509|V226_FOWPN Probable serine/threonine-protein kinase FPV226 OS=Fowlpox virus (strain NVSL) GN=FPV226 PE=3 SV=1 595 866 4.0E-13
sp|Q8K3G5|VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus GN=Vrk3 PE=1 SV=2 656 873 9.0E-13
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 596 812 1.0E-12
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 64 275 2.0E-12
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 64 406 2.0E-12
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 596 842 2.0E-12
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 64 406 2.0E-12
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 61 404 4.0E-12
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 64 275 4.0E-12
sp|P34635|YOO3_CAEEL Putative serine/threonine-protein kinase ZK507.3 OS=Caenorhabditis elegans GN=ZK507.3 PE=3 SV=3 600 865 4.0E-12
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 61 282 5.0E-12
sp|A8WU31|VRK1_CAEBR Serine/threonine-protein kinase VRK1 OS=Caenorhabditis briggsae GN=vrk-1 PE=3 SV=1 601 816 5.0E-12
sp|Q2YDN8|VRK3_BOVIN Inactive serine/threonine-protein kinase VRK3 OS=Bos taurus GN=VRK3 PE=2 SV=1 656 873 6.0E-12
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 61 404 7.0E-12
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 64 275 1.0E-11
sp|Q8IV63|VRK3_HUMAN Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens GN=VRK3 PE=1 SV=2 656 873 1.0E-11
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 63 405 1.0E-11
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 64 406 2.0E-11
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 601 899 2.0E-11
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 64 275 2.0E-11
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 581 842 2.0E-11
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 64 275 2.0E-11
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 64 406 3.0E-11
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 64 275 3.0E-11
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 64 420 3.0E-11
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 600 809 4.0E-11
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 64 406 4.0E-11
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 601 821 5.0E-11
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 601 821 5.0E-11
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 601 821 5.0E-11
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 601 821 5.0E-11
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 64 405 5.0E-11
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 63 420 1.0E-10
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 601 821 1.0E-10
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 601 809 1.0E-10
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 64 404 1.0E-10
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 600 809 2.0E-10
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 601 807 2.0E-10
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 600 809 2.0E-10
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 601 806 2.0E-10
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 64 275 3.0E-10
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 64 275 3.0E-10
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 551 833 3.0E-10
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 596 809 4.0E-10
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 600 818 6.0E-10
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 601 814 7.0E-10
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 594 858 7.0E-10
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 601 814 7.0E-10
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 601 814 7.0E-10
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 601 822 9.0E-10
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 601 830 9.0E-10
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 61 283 1.0E-09
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 64 404 2.0E-09
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 607 809 3.0E-09
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 601 807 3.0E-09
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 601 824 3.0E-09
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 601 807 3.0E-09
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 66 448 3.0E-09
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 584 810 4.0E-09
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 601 807 4.0E-09
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 606 813 4.0E-09
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 606 813 4.0E-09
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 601 807 4.0E-09
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 601 824 5.0E-09
sp|P9WI79|PKND_MYCTU Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknD PE=1 SV=1 601 863 5.0E-09
sp|P9WI78|PKND_MYCTO Serine/threonine-protein kinase PknD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknD PE=1 SV=1 601 863 5.0E-09
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 600 809 5.0E-09
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 601 773 6.0E-09
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 597 773 6.0E-09
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 601 826 6.0E-09
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 64 275 6.0E-09
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 64 406 6.0E-09
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 599 823 6.0E-09
sp|Q19848|VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans GN=vrk-1 PE=1 SV=1 584 816 7.0E-09
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 600 807 7.0E-09
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 604 833 9.0E-09
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 601 809 9.0E-09
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 606 803 1.0E-08
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 606 803 1.0E-08
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 599 822 1.0E-08
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 601 809 1.0E-08
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 64 406 1.0E-08
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 601 807 1.0E-08
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 607 807 1.0E-08
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 593 914 1.0E-08
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 597 808 1.0E-08
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 600 807 2.0E-08
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 601 810 2.0E-08
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 597 806 2.0E-08
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 64 420 2.0E-08
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 601 749 3.0E-08
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 64 420 3.0E-08
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 607 807 3.0E-08
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 606 822 3.0E-08
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 601 749 3.0E-08
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 606 803 3.0E-08
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 601 807 4.0E-08
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 607 835 4.0E-08
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 597 807 4.0E-08
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 61 275 4.0E-08
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 600 797 4.0E-08
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 601 807 4.0E-08
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 600 809 4.0E-08
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 600 809 4.0E-08
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 601 809 5.0E-08
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 601 809 5.0E-08
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 600 809 5.0E-08
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 600 809 5.0E-08
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 603 807 6.0E-08
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 601 821 6.0E-08
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 601 813 6.0E-08
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 601 807 7.0E-08
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 601 822 7.0E-08
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 601 822 8.0E-08
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 606 822 9.0E-08
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 601 816 9.0E-08
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 601 775 9.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 600 809 1.0E-07
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 600 809 1.0E-07
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 574 807 1.0E-07
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 601 816 1.0E-07
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 607 809 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 600 809 1.0E-07
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 601 830 1.0E-07
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 586 751 1.0E-07
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 601 821 1.0E-07
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 601 806 1.0E-07
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 601 896 1.0E-07
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 600 807 1.0E-07
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 509 755 1.0E-07
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 600 809 1.0E-07
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 601 819 2.0E-07
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 601 816 2.0E-07
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 601 809 2.0E-07
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 597 807 2.0E-07
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 595 830 2.0E-07
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 597 773 2.0E-07
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 596 850 2.0E-07
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 601 816 2.0E-07
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 600 809 2.0E-07
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 601 809 2.0E-07
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 600 807 2.0E-07
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 601 816 2.0E-07
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 600 856 2.0E-07
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 596 807 2.0E-07
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 551 809 2.0E-07
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 601 814 2.0E-07
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 601 807 2.0E-07
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 572 807 2.0E-07
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 596 807 2.0E-07
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 600 856 2.0E-07
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 600 809 2.0E-07
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 593 830 3.0E-07
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 601 728 3.0E-07
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 606 748 3.0E-07
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 607 869 3.0E-07
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 598 807 3.0E-07
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 606 748 3.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 593 807 3.0E-07
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 607 809 4.0E-07
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 593 809 4.0E-07
sp|Q9FAB3|SPKA_SYNY3 Serine/threonine-protein kinase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkA PE=1 SV=1 585 806 4.0E-07
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 601 810 4.0E-07
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 588 811 4.0E-07
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 703 840 4.0E-07
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 601 807 4.0E-07
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 598 807 4.0E-07
sp|P9WI77|PKNE_MYCTU Serine/threonine-protein kinase PknE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknE PE=1 SV=1 601 809 4.0E-07
sp|P9WI76|PKNE_MYCTO Serine/threonine-protein kinase PknE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknE PE=3 SV=1 601 809 4.0E-07
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 598 830 4.0E-07
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 598 830 4.0E-07
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 586 822 5.0E-07
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 600 809 5.0E-07
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 601 809 5.0E-07
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 601 811 5.0E-07
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 600 811 6.0E-07
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 606 748 6.0E-07
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 595 747 6.0E-07
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 605 747 6.0E-07
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 601 824 6.0E-07
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 601 811 6.0E-07
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 601 807 6.0E-07
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 578 753 7.0E-07
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 601 753 7.0E-07
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 588 811 7.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 600 809 7.0E-07
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 601 807 7.0E-07
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 601 807 7.0E-07
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 606 753 7.0E-07
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 601 844 7.0E-07
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 601 807 7.0E-07
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 601 822 8.0E-07
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 606 748 8.0E-07
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 601 753 8.0E-07
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 606 748 8.0E-07
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 601 748 8.0E-07
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 601 806 8.0E-07
sp|P74745|SPKC_SYNY3 Serine/threonine-protein kinase C OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkC PE=1 SV=1 592 806 8.0E-07
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 593 807 8.0E-07
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 649 822 8.0E-07
sp|Q1DB00|MASK_MYXXD Tyrosine-protein kinase MasK OS=Myxococcus xanthus (strain DK 1622) GN=masK PE=1 SV=1 585 896 8.0E-07
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 596 842 9.0E-07
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 601 822 9.0E-07
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 601 809 9.0E-07
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 65 431 9.0E-07
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 601 809 9.0E-07
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 601 808 9.0E-07
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 596 842 1.0E-06
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 596 842 1.0E-06
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 601 753 1.0E-06
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 601 753 1.0E-06
sp|Q12310|PRR2_YEAST Serine/threonine-protein kinase PRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR2 PE=1 SV=1 593 808 1.0E-06
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 606 748 1.0E-06
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 598 830 1.0E-06
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 601 753 1.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 607 809 1.0E-06
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 601 807 1.0E-06
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 601 833 1.0E-06
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 601 816 1.0E-06
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 600 818 1.0E-06
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 601 812 1.0E-06
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 600 804 1.0E-06
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 601 807 1.0E-06
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 581 831 1.0E-06
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 601 822 1.0E-06
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 581 831 1.0E-06
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 50 438 1.0E-06
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 588 824 1.0E-06
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 538 831 1.0E-06
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 606 748 1.0E-06
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 600 810 2.0E-06
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 593 747 2.0E-06
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 601 807 2.0E-06
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 601 807 2.0E-06
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 600 773 2.0E-06
sp|P64766|Y968_MYCBO Uncharacterized protein Mb0968c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0968c PE=4 SV=1 320 501 2.0E-06
sp|P9WKN7|Y943_MYCTU Uncharacterized protein Rv0943c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0943c PE=4 SV=1 320 501 2.0E-06
sp|P9WKN6|Y943_MYCTO Uncharacterized protein MT0969 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0969 PE=4 SV=1 320 501 2.0E-06
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 576 753 2.0E-06
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 601 808 2.0E-06
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 600 923 2.0E-06
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 601 807 2.0E-06
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 668 809 2.0E-06
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 586 810 2.0E-06
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 601 807 2.0E-06
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 576 807 2.0E-06
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 596 749 2.0E-06
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 601 807 2.0E-06
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 604 807 2.0E-06
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 601 807 2.0E-06
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 601 807 2.0E-06
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 606 773 3.0E-06
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 600 822 3.0E-06
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 591 747 3.0E-06
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 591 747 3.0E-06
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 600 810 3.0E-06
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 591 747 3.0E-06
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 606 748 3.0E-06
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 592 830 3.0E-06
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 606 748 3.0E-06
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 601 869 3.0E-06
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 606 882 3.0E-06
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 601 816 3.0E-06
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 583 807 3.0E-06
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 601 816 4.0E-06
sp|O94235|MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mph1 PE=2 SV=1 583 811 4.0E-06
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 589 771 4.0E-06
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 601 831 4.0E-06
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 601 809 4.0E-06
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 601 751 4.0E-06
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 600 809 4.0E-06
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 606 748 4.0E-06
sp|P46892|CD11B_RAT Cyclin-dependent kinase 11B OS=Rattus norvegicus GN=Cdk11b PE=1 SV=1 600 875 4.0E-06
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 601 822 4.0E-06
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 634 830 4.0E-06
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 601 758 5.0E-06
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 591 752 5.0E-06
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 586 810 5.0E-06
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 599 807 5.0E-06
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 606 773 6.0E-06
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 601 809 6.0E-06
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 606 773 6.0E-06
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 607 775 6.0E-06
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 607 809 6.0E-06
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 606 747 6.0E-06
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 601 822 6.0E-06
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 607 775 6.0E-06
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 601 809 6.0E-06
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 601 749 6.0E-06
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 582 809 6.0E-06
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 597 810 6.0E-06
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 606 773 6.0E-06
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 607 821 7.0E-06
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 606 773 7.0E-06
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 601 807 7.0E-06
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 606 773 7.0E-06
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 606 935 8.0E-06
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 578 751 8.0E-06
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 606 773 8.0E-06
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 572 746 8.0E-06
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 602 807 9.0E-06
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 606 753 9.0E-06
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 600 812 1.0E-05
sp|Q9PK92|PKND_CHLMU Serine/threonine-protein kinase PknD OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pknD PE=3 SV=1 601 834 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0004672 protein kinase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0043412 macromolecule modification No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0016301 kinase activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:0016310 phosphorylation No
GO:0000166 nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0004497 monooxygenase activity No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055710
MLLVVLIIYKGQALTLSLFPSALVHLVLLDCCWILGTCYIPETLTIKDEMAGEDRKSSERKPHIAIIGAGVGGIS
AAIQLRRQLGYENFTIYEKADAVGGTWRSNTYPGCGCDVAAHWYSLSTDLNPDWKSYYVNQPEIYAYWKGLWKKH
NLISHTKLSTSVSSAEWDEGNHKYKLVVKDEKNKEETSVEAEIVIWAIGGFFDPLYPKELEGGLGKFKGTLFHSA
RWRHDVELKGKRVGVIGNGCSAAQFIPEISKDPSVEVINFCRTPQWFVPREDRQYSPTTKWVFRNIPLVLRWYRN
MIMARSDLSALMFRKENKLVTRLARRELAGYIKRMAPKEYVDKLIPDYSPGCKRIIVDPDYLKSLHRPNVSLSWD
GIEEIVEEGIKLKTGEVVALDIIIFGTGYSLEPKGWDIKGSNGKALKEYFDEQGGPTAYLGTSMPGFPNLYMLLG
PNVATGHASVIFSQEAQINLAIQLIKPVLDGKAKSFAITSSATDEYNDWLQKRLRTDVSRAGGAVLVAVAPAGVG
AVQGGGSGGVGAGAPGDGGAAGCVGGVGGGGNCGRIWASDHFVLSLSTGLAWPALFLPLPMSQHPATTANLVGIH
YRVGRKIGEGSFGVIFEGTNLLNSQTVAIKFEPRKAEAPQLRDECRSYRILAGCTGIPQIYHFGQEGLHNILVID
LLGPSLEDLFDMCGRKFSTKTVCMAARQMITRVQTIHEKNLIYRDIKPDNFLIGRPNTKGANIIHVVDFGMAKQY
RDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLESLGHVFMYFLRGSLPWQGLKAATNKQKYEKIGEK
KQMTPIKELCEGFPEEFGIYLNYVRKLGFEETPDYDFLRELFVKVMKNNGDMDDGVFDWNLLNEGRGWESTPGQQ
NSNAVLNQMQSGADRKRDTREDRRRSQNPVAPPSPALVRHGSKTRKIPNALIPGATGQQTPQSAAAQANVSTATQ
RGTHPYANAVNGGYEGYDVANASYNTQQYPRLSQAGDYHGQDIDEPPRKNTLLRILTCRC*
Coding >AgabiH97|055710
ATGCTACTGGTTGTTCTAATCATATATAAGGGCCAGGCACTGACTCTTTCATTGTTCCCGTCAGCCCTTGTTCAC
TTGGTCTTACTAGATTGTTGCTGGATTCTAGGCACGTGCTATATTCCCGAGACGCTTACCATCAAAGACGAAATG
GCTGGGGAGGATAGGAAGAGTTCTGAGAGAAAACCTCATATAGCCATTATTGGTGCTGGAGTGGGAGGTATTTCT
GCTGCTATACAACTTCGACGTCAGTTGGGTTATGAGAACTTTACTATTTATGAAAAGGCGGATGCGGTTGGTGGA
ACGTGGAGAAGTAACACATACCCCGGATGTGGTTGTGATGTAGCAGCTCATTGGTATTCCCTCTCAACCGATCTA
AATCCCGACTGGAAAAGTTACTACGTCAATCAACCCGAAATATACGCCTACTGGAAAGGGTTATGGAAAAAACAC
AATTTGATATCACATACAAAACTGTCTACAAGTGTCTCTTCTGCTGAATGGGATGAAGGAAATCACAAGTATAAA
CTGGTTGTCAAAGATGAAAAGAATAAGGAAGAAACGAGTGTGGAAGCTGAAATTGTGATTTGGGCTATTGGTGGG
TTTTTTGATCCTTTGTATCCAAAGGAGTTGGAAGGGGGGTTGGGGAAGTTTAAGGGGACGTTGTTTCATTCGGCT
AGGTGGAGACATGATGTTGAGTTGAAGGGAAAGAGGGTTGGTGTGATTGGGAATGGGTGTTCTGCGGCACAGTTT
ATACCTGAGATCTCGAAGGATCCGTCTGTGGAGGTTATCAACTTTTGTCGTACACCGCAGTGGTTTGTGCCTCGT
GAGGATCGTCAATACTCGCCTACTACGAAATGGGTATTCCGGAATATACCACTCGTATTGCGTTGGTATCGTAAC
ATGATTATGGCTAGGTCTGATTTGAGTGCTTTGATGTTCCGCAAGGAGAACAAGTTGGTGACCAGACTGGCGAGG
AGGGAGCTGGCTGGTTATATCAAGCGCATGGCTCCCAAGGAGTACGTGGATAAGCTAATTCCGGATTACTCTCCT
GGCTGTAAGAGGATCATTGTTGATCCCGACTACCTCAAGTCCCTCCACAGGCCCAATGTATCACTGAGTTGGGAT
GGCATCGAGGAGATTGTCGAGGAAGGTATCAAGCTCAAGACGGGAGAAGTGGTTGCCTTGGATATAATCATTTTC
GGGACTGGCTACTCTCTAGAACCCAAAGGATGGGATATCAAAGGAAGTAATGGCAAGGCGCTGAAAGAGTATTTC
GACGAACAAGGTGGTCCGACGGCGTATTTAGGTACTTCGATGCCTGGCTTCCCGAACCTCTACATGCTTCTGGGG
CCAAACGTGGCGACGGGACACGCGTCTGTCATTTTCAGCCAGGAAGCGCAGATCAACCTGGCGATCCAGCTGATC
AAGCCGGTGCTGGATGGCAAGGCCAAGTCGTTTGCGATCACGAGCTCGGCCACGGACGAGTACAACGACTGGCTG
CAGAAACGACTGCGGACCGACGTTTCCCGGGCCGGTGGCGCTGTTCTGGTGGCTGTCGCGCCGGCCGGAGTGGGG
GCGGTACAAGGGGGAGGGAGCGGAGGCGTGGGAGCTGGAGCGCCGGGAGACGGGGGTGCGGCGGGTTGTGTTGGC
GGTGTTGGCGGTGGTGGGAACTGTGGCCGTATTTGGGCCTCTGATCACTTTGTGCTTTCGCTCTCCACCGGCCTC
GCCTGGCCTGCCCTCTTCCTCCCTCTACCCATGTCCCAACACCCCGCCACCACTGCCAACCTCGTCGGCATCCAC
TACCGCGTCGGCAGGAAAATCGGCGAGGGTTCCTTTGGTGTCATCTTCGAAGGCACAAACCTCCTCAACTCCCAG
ACGGTTGCCATCAAGTTTGAACCCCGCAAGGCCGAGGCTCCCCAACTCCGTGACGAATGCCGCTCTTACCGTATT
CTCGCAGGATGCACTGGCATTCCGCAGATTTACCATTTCGGCCAAGAGGGTCTACATAACATTCTAGTCATCGAT
TTACTCGGCCCAAGTCTAGAAGACCTCTTCGACATGTGTGGGAGGAAGTTTTCAACAAAGACCGTTTGTATGGCT
GCCCGCCAAATGATTACCCGTGTTCAGACCATTCATGAAAAAAACCTCATATATCGCGACATAAAGCCGGACAAT
TTCCTAATAGGGCGCCCCAACACCAAGGGAGCCAATATCATTCATGTCGTCGATTTCGGTATGGCCAAGCAATAT
CGAGATCCGAAAACGAAGCAGCACATACCGTACCGAGAGCGCAAGAGTCTGAGTGGCACAGCGCGATACATGAGC
ATCAACACACATCTTGGCCGAGAACAGTCACGGAGGGATGACCTAGAATCATTGGGCCATGTCTTCATGTACTTC
CTCAGAGGAAGCCTGCCTTGGCAAGGCCTCAAGGCAGCCACAAACAAACAGAAGTACGAAAAGATTGGTGAGAAG
AAGCAGATGACCCCCATCAAAGAACTCTGCGAAGGCTTTCCCGAGGAGTTTGGAATTTATCTAAACTACGTCCGC
AAACTTGGGTTTGAGGAGACGCCCGATTATGATTTCTTGAGAGAACTGTTCGTGAAGGTTATGAAAAACAACGGG
GATATGGATGACGGAGTGTTTGATTGGAACCTCCTTAATGAGGGGCGTGGATGGGAGTCGACTCCTGGTCAACAG
AATTCGAACGCCGTTCTCAATCAAATGCAGTCGGGGGCTGATCGAAAGCGTGACACTCGCGAAGACCGACGACGG
TCGCAAAACCCCGTTGCCCCTCCTTCCCCAGCCCTCGTCCGCCATGGTTCCAAGACACGGAAGATCCCTAATGCA
CTGATTCCCGGTGCTACCGGGCAACAGACGCCTCAATCTGCCGCTGCCCAGGCCAATGTTTCCACCGCGACTCAA
AGAGGCACGCATCCATATGCGAATGCTGTCAATGGTGGTTATGAGGGCTATGACGTTGCAAATGCGAGTTATAAT
ACTCAGCAATATCCCCGTTTGTCCCAAGCTGGTGACTATCATGGACAAGACATAGACGAACCACCTCGGAAAAAC
ACACTCCTTAGAATTCTCACTTGCAGGTGTTAG
Transcript >AgabiH97|055710
ATGCTACTGGTTGTTCTAATCATATATAAGGGCCAGGCACTGACTCTTTCATTGTTCCCGTCAGCCCTTGTTCAC
TTGGTCTTACTAGATTGTTGCTGGATTCTAGGCACGTGCTATATTCCCGAGACGCTTACCATCAAAGACGAAATG
GCTGGGGAGGATAGGAAGAGTTCTGAGAGAAAACCTCATATAGCCATTATTGGTGCTGGAGTGGGAGGTATTTCT
GCTGCTATACAACTTCGACGTCAGTTGGGTTATGAGAACTTTACTATTTATGAAAAGGCGGATGCGGTTGGTGGA
ACGTGGAGAAGTAACACATACCCCGGATGTGGTTGTGATGTAGCAGCTCATTGGTATTCCCTCTCAACCGATCTA
AATCCCGACTGGAAAAGTTACTACGTCAATCAACCCGAAATATACGCCTACTGGAAAGGGTTATGGAAAAAACAC
AATTTGATATCACATACAAAACTGTCTACAAGTGTCTCTTCTGCTGAATGGGATGAAGGAAATCACAAGTATAAA
CTGGTTGTCAAAGATGAAAAGAATAAGGAAGAAACGAGTGTGGAAGCTGAAATTGTGATTTGGGCTATTGGTGGG
TTTTTTGATCCTTTGTATCCAAAGGAGTTGGAAGGGGGGTTGGGGAAGTTTAAGGGGACGTTGTTTCATTCGGCT
AGGTGGAGACATGATGTTGAGTTGAAGGGAAAGAGGGTTGGTGTGATTGGGAATGGGTGTTCTGCGGCACAGTTT
ATACCTGAGATCTCGAAGGATCCGTCTGTGGAGGTTATCAACTTTTGTCGTACACCGCAGTGGTTTGTGCCTCGT
GAGGATCGTCAATACTCGCCTACTACGAAATGGGTATTCCGGAATATACCACTCGTATTGCGTTGGTATCGTAAC
ATGATTATGGCTAGGTCTGATTTGAGTGCTTTGATGTTCCGCAAGGAGAACAAGTTGGTGACCAGACTGGCGAGG
AGGGAGCTGGCTGGTTATATCAAGCGCATGGCTCCCAAGGAGTACGTGGATAAGCTAATTCCGGATTACTCTCCT
GGCTGTAAGAGGATCATTGTTGATCCCGACTACCTCAAGTCCCTCCACAGGCCCAATGTATCACTGAGTTGGGAT
GGCATCGAGGAGATTGTCGAGGAAGGTATCAAGCTCAAGACGGGAGAAGTGGTTGCCTTGGATATAATCATTTTC
GGGACTGGCTACTCTCTAGAACCCAAAGGATGGGATATCAAAGGAAGTAATGGCAAGGCGCTGAAAGAGTATTTC
GACGAACAAGGTGGTCCGACGGCGTATTTAGGTACTTCGATGCCTGGCTTCCCGAACCTCTACATGCTTCTGGGG
CCAAACGTGGCGACGGGACACGCGTCTGTCATTTTCAGCCAGGAAGCGCAGATCAACCTGGCGATCCAGCTGATC
AAGCCGGTGCTGGATGGCAAGGCCAAGTCGTTTGCGATCACGAGCTCGGCCACGGACGAGTACAACGACTGGCTG
CAGAAACGACTGCGGACCGACGTTTCCCGGGCCGGTGGCGCTGTTCTGGTGGCTGTCGCGCCGGCCGGAGTGGGG
GCGGTACAAGGGGGAGGGAGCGGAGGCGTGGGAGCTGGAGCGCCGGGAGACGGGGGTGCGGCGGGTTGTGTTGGC
GGTGTTGGCGGTGGTGGGAACTGTGGCCGTATTTGGGCCTCTGATCACTTTGTGCTTTCGCTCTCCACCGGCCTC
GCCTGGCCTGCCCTCTTCCTCCCTCTACCCATGTCCCAACACCCCGCCACCACTGCCAACCTCGTCGGCATCCAC
TACCGCGTCGGCAGGAAAATCGGCGAGGGTTCCTTTGGTGTCATCTTCGAAGGCACAAACCTCCTCAACTCCCAG
ACGGTTGCCATCAAGTTTGAACCCCGCAAGGCCGAGGCTCCCCAACTCCGTGACGAATGCCGCTCTTACCGTATT
CTCGCAGGATGCACTGGCATTCCGCAGATTTACCATTTCGGCCAAGAGGGTCTACATAACATTCTAGTCATCGAT
TTACTCGGCCCAAGTCTAGAAGACCTCTTCGACATGTGTGGGAGGAAGTTTTCAACAAAGACCGTTTGTATGGCT
GCCCGCCAAATGATTACCCGTGTTCAGACCATTCATGAAAAAAACCTCATATATCGCGACATAAAGCCGGACAAT
TTCCTAATAGGGCGCCCCAACACCAAGGGAGCCAATATCATTCATGTCGTCGATTTCGGTATGGCCAAGCAATAT
CGAGATCCGAAAACGAAGCAGCACATACCGTACCGAGAGCGCAAGAGTCTGAGTGGCACAGCGCGATACATGAGC
ATCAACACACATCTTGGCCGAGAACAGTCACGGAGGGATGACCTAGAATCATTGGGCCATGTCTTCATGTACTTC
CTCAGAGGAAGCCTGCCTTGGCAAGGCCTCAAGGCAGCCACAAACAAACAGAAGTACGAAAAGATTGGTGAGAAG
AAGCAGATGACCCCCATCAAAGAACTCTGCGAAGGCTTTCCCGAGGAGTTTGGAATTTATCTAAACTACGTCCGC
AAACTTGGGTTTGAGGAGACGCCCGATTATGATTTCTTGAGAGAACTGTTCGTGAAGGTTATGAAAAACAACGGG
GATATGGATGACGGAGTGTTTGATTGGAACCTCCTTAATGAGGGGCGTGGATGGGAGTCGACTCCTGGTCAACAG
AATTCGAACGCCGTTCTCAATCAAATGCAGTCGGGGGCTGATCGAAAGCGTGACACTCGCGAAGACCGACGACGG
TCGCAAAACCCCGTTGCCCCTCCTTCCCCAGCCCTCGTCCGCCATGGTTCCAAGACACGGAAGATCCCTAATGCA
CTGATTCCCGGTGCTACCGGGCAACAGACGCCTCAATCTGCCGCTGCCCAGGCCAATGTTTCCACCGCGACTCAA
AGAGGCACGCATCCATATGCGAATGCTGTCAATGGTGGTTATGAGGGCTATGACGTTGCAAATGCGAGTTATAAT
ACTCAGCAATATCCCCGTTTGTCCCAAGCTGGTGACTATCATGGACAAGACATAGACGAACCACCTCGGAAAAAC
ACACTCCTTAGAATTCTCACTTGCAGGTGTTAG
Gene >AgabiH97|055710
ATGCTACTGGTTGTTCTAATCATATATAAGGGCCAGGCACTGACTCTTTCATTGTTCCCGTCAGCCCTTGTTCAC
TTGGTCTTACTAGATTGTTGCTGGTGCGTTTTGCGTTCATTTCTGGTCAACGCTTCTAGCTCGAATTGATTCATT
TTGAATTGACTGACGCCCCGTGTAAAATGTAGGATTCTAGGCACGTGCTATATTCCCGAGACGCTTACCATCAAA
GACGAAATGGCTGGGGAGGATAGGAAGAGTTCTGAGAGAAAACCTCATATAGCCATTATTGGTGCTGGGTGAGTT
TAGTCACTTACTAATATTTGTTAAACAACGGTTATTTGAATTATCTTGATTAGAGTGGGAGGTATTTCTGCTGCT
ATACAACTTCGACGTCAGTTGGGTTATGAGAACTTTACTGTGAGTGTTGTTTGAATTTGGGTGTTGTGGGGTTTT
TTTTTTTTACTTATTTTTTGGTGTGGTAAGATTTATGAAAAGGCGGATGCGGTTGGTGGAACGTGGAGAGTGAGT
TTTTGTGAATGGTTGATCTCGAGAAATGGTATTCTAATACAAAGAGCTCATTTCACAGAGTAACACATACCCCGT
ACGACTCTTTCCTTTCTCTCTCTCTCATCCTTTAGAACTAAAAACATCAACAACAAAGGGATGTGGTTGTGATGT
AGCAGCTCATTGGTATTCCCTCTCAACCGATCTAAATCCCGACTGGAAAAGTTACTACGTCAATCAACCCGAAAT
ATACGCCTACTGGAAAGGGTTATGGAAAAAACACAATTTGATATCACATACAAAACTGTCTACAAGTGTCTCTTC
TGCTGAATGGGATGAAGGAAATCACAAGTATAAACTGGTTGTCAAAGATGAAAAGAATAAGGAAGAAACGAGTGT
GGAAGCTGAAATTGTGATTTGGGCTATTGGTGGGTTTTTTGATCCTTTGTATCCAAAGGAGTTGGAAGGGGGGTT
GGGGAAGTTTAAGGGGACGTTGTTTCATTCGGCTAGGTGGAGACATGATGTTGAGTTGAAGGGAAAGAGGGTTGG
TGTGATTGGGAATGGGTGTTCTGCGTGAGTTTTTTTTTTTTTTTCGTATTGTGCGTTAATAATTTTTGATTTTAT
TGGATGATATAGGGCACAGTTTATACCTGAGATCTCGAAGGATCCGTCTGTGGAGGTTATCAACTTTTGTCGTAC
ACCGCAGTGGTTTGTGCCTCGTGTAGGTGCATTCATTTTGATAACGAGATATGTTATTTACCAAAAGTATTCTAG
GAGGATCGTCAATACTCGCCTACTACGAAATGGGTATTCCGGAATATACCACTCGTATTGCGTTGGTATCGTAAC
ATGATTATGGCTAGGGTATGTCTTTTTCCTCTTTTGTGATTCATGCGTTGCTGATTGAAAACCATAGTCTGATTT
GAGTGCTTTGATGTTCCGCAAGGAGAACAAGTTGGTGACCAGACTGGCGAGGAGGGTAAGTCCAGCTGGGATAAT
GCTAGAGTTTCTTACCGATGTGGTTAAAGGAGCTGGCTGGTTATATCAAGCGCATGGCTCCCAAGGAGTACGTGG
ATAAGCTAATTCCGGATTACTGTAAGTGTTTTAAGTTTGCTTTGAGCTCCTATCTAACGATATAAAGCTCCTGGC
TGTAAGAGGATCATTGTTGATCCCGACTACCTCAAGTCCCTCCACAGGCCCAATGTATCACTGAGTTGGGATGGC
ATCGAGGAGATTGTCGAGGAAGGTATCAAGCTCAAGACGGGAGAAGTGGTTGCCTTGGATATAATCATTTTCGGG
ACTGGCTACTCTCTAGTACGTTGGTGACTTCTCGGAGTTCACGGTATTAATGCCGTGGGGGTATCGCTAGGAACC
CAAAGGATGGGATATCAAAGGAAGTAATGGCAAGGCGCTGAAAGAGTATTTCGACGAACAAGGTGGTCCGACGGC
GTATTTAGGTACTTCGATGCCTGGCTTCCCGAACCTCTACATGCTTCTGGGTAGGTCTGGTGACTGGTGCGAGAG
AGATAGCGAGGTTAAATTGTCTTTAGGGCCAAACGTGGCGACGGGACACGCGTCTGTCATTTTCAGCCAGGAAGC
GCAGGTAAATTGTGTGATAGATTGTCGATGTTGAGTTGCTCATGGATTTATGGCGCAGATCAACCTGGCGATCCA
GCTGATCAAGCCGGTGCTGGATGGCAAGGCCAAGTCGTTTGCGATCACGAGCTCGGCCACGGACGAGTACAACGA
CTGGCTGCAGAAACGACTGCGGACGTCTGTGTGGACTGACTGCATGAGCTACTACCGGAAGGACAGGGAGCTGGG
GAAGATCATAGCGACGTTTCCCGGGCCGGTGGCGCTGTTCTGGTGGCTGTCGCGCCGGCCGGAGTGGGGGCGGTA
CAAGGGGGAGGGAGCGGAGGCGTGGGAGCTGGAGCGCCGGGAGACGGGGGTGCGGCGGGTTGTGTTGGCGGTGTT
GGCGGTGGTGGGAACGTGTGGAGGCCTTGTGTTGCTGTACTTGACTTAACTTAGTGTAACTTATTTTGAGTGTGG
CCGTATTTGGGCCTCTGATCACTTTGTGCTTTCGCTCTCCACCGGCCTCGCCTGGCCTGCCCTCTTCCTCCCTCT
ACCCATGTCCCAACACCCCGCCACCACTGCCAACCTCGTCGGCATCCACTACCGCGTCGGCAGGAAAATCGGCGA
GGGTTCCTTTGGTGTCATCTTCGAAGGTCTGCTCTCTCTCTCTCCCGCTGTCCTCGCTGCTCCCGCTCATCCCCC
CCCCCTCTCCAGGCACAAACCTCCTCAACTCCCAGACGGTTGCCATCAAGTTTGTGCGTTGTCCGCAGCACCCCC
GTCATACCATGCTCATTTCCTCTCCTCTCCCCCCCCCTCGACTAGGAACCCCGCAAGGCCGAGGCTCCCCAACTC
CGTGACGAATGCCGCTCTTACCGTATTCTCGCAGGATGCAGTGCGTGCTCTCGCCGTGACGCCCCCGTTTCGCTC
CCCCTCATTGTTTTTGCCAAATTTAGCTGGCATTCCGCAGATTTACCATTTCGGCCAAGAGGGTCTACATAACAT
TCTAGTCATCGATTTACTCGGCCCAAGTCTAGAAGACCTCTTCGACATGTGTGGGAGGAAGTTTTCAACAAAGAC
CGTTTGTATGGCTGCCCGCCAAATGGTCAGTAACAGAGCTCACCCCTTAGCCTTTTAGTCATGCTCCTCTCCAGA
TTACCCGTGTTCAGACCATTCATGAAAAAAACCTCATATATCGCGACATAAAGCCGGACAATTTCCTAATAGGGC
GCCCCAACACCAAGGGAGCCAATAGTGAGCATCAGCCTCAGGTATACAATACATAGCTTTCCTCACCCCGTCCGC
AGTCATTCATGTCGTCGATTTCGGTATGGCCAAGCAATATCGAGATCCGAAAACGAAGCAGCACATACCGTACCG
AGAGCGCAAGAGTCTGAGTGGCACAGCGCGATACATGAGCATCAACACACATCTTGGCCGAGGTACCCCAATCCG
GCTCTTGTATATTGCATCCGTTTTTCTCACTTCTTGTCCGATATAGAACAGTCACGGAGGGATGACCTAGAATCA
TTGGGCCATGTCTTCATGTACTTCCTCAGAGGAAGCCTGCCTTGGCAAGGCCTCAAGGCAGCCACAAACAAACAG
AAGTACGAAAAGATTGGTGAGAAGAAGCAGATGACCCCCATCAAAGAACTCTGCGAAGGCTTTCCCGGTATGTAA
TACTATCCGCTGTTTACGGTGCATTCTGATCAGATGTATGTTAGAGGAGTTTGGAATTTATCTAAACTACGTCCG
CAAACTTGGGTTTGAGGAGACGCCCGATTATGATTTCTTGAGAGAACTGTTCGTGAAGGTTATGAAAAACAACGG
GGATATGGATGACGGAGTGTTTGATTGGAACCTCCTTAATGGTATGTTCATAACTCTGTTCCTGGTCCTGACTTT
TGTTCTCACCCATATTATCATCGCTAGAGGGGCGTGGATGGGAGTCGACTCCTGGTGTAAGTATCACACGGTTGC
TACAAATTTTTATTGAACTGATAAATTCCATTAGCAACAGAATTCGAACGCCGTTCTCAATCAAATGCAGTCGGG
GGCTGATCGAAAGCGTGACACTCGCGAAGACCGACGACGGTCGCAAAACCCCGTTGCCCCTCCTTCCCCAGCCCT
CGTCCGCCATGGTTCCAAGACACGGAAGATCCCTAATGCACTGATTCCCGGTGCTACCGGGCAACAGACGCCTCA
ATCTGCCGCTGCCCAGGCCAATGTTTCCACCGCGACTCAAAGAGGCACGCATCCATATGCGAATGCTGTCAATGG
TGGTTATGAGGGCTATGACGTTGCAAATGCGAGTTATAATACTCAGCAATATCCCCGTGCGTCACCCATGTCGCC
TGGTGCTGGTGCACTACCACCTGCAGTCAGTCAGGTCCGTGCTCAGGCTGGTCCAACAGGTTTGTCCCAAGCTGG
TGACTATCATGGACAAGACATAGACGAACCACCTCGGAAAAACACACTCCTTAGAATTCTCACTTGCAGGTGTTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail