Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055580
Gene name
Locationscaffold_3:733459..734371
Strand+
Gene length (bp)912
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 3.8E-59 22 179
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 2.1E-37 22 136
PF00025 Arf ADP-ribosylation factor family 3.0E-16 18 178
PF09439 SRPRB Signal recognition particle receptor beta subunit 3.7E-07 20 144
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.3E-05 22 130
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.1E-05 22 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 20 214 2.0E-100
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 19 214 3.0E-100
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 10 214 2.0E-99
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 10 214 2.0E-99
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 10 214 2.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 20 214 2.0E-100
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 19 214 3.0E-100
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 10 214 2.0E-99
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 10 214 2.0E-99
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 10 214 2.0E-99
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 10 214 2.0E-99
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 10 214 9.0E-99
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 10 214 1.0E-97
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 10 214 1.0E-97
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 10 214 1.0E-97
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 11 214 3.0E-97
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 14 214 6.0E-97
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 10 214 7.0E-97
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 20 214 2.0E-95
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 14 214 4.0E-95
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 11 188 5.0E-95
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 14 202 5.0E-87
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 20 214 1.0E-84
sp|Q9H0N0|RAB6C_HUMAN Ras-related protein Rab-6C OS=Homo sapiens GN=RAB6C PE=1 SV=2 10 214 2.0E-84
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 19 214 2.0E-80
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 20 181 2.0E-76
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 22 188 4.0E-50
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 22 188 4.0E-50
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 22 188 4.0E-50
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 22 212 5.0E-50
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 21 212 5.0E-50
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 22 212 1.0E-49
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 22 202 2.0E-49
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 22 188 2.0E-49
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 22 212 2.0E-49
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 22 212 2.0E-49
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 22 212 2.0E-49
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 22 212 3.0E-49
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 22 188 3.0E-49
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 22 188 3.0E-49
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 22 190 3.0E-49
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 22 188 4.0E-49
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 22 188 4.0E-49
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 22 182 1.0E-48
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 22 212 4.0E-48
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 22 212 1.0E-47
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 17 214 3.0E-47
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 22 214 3.0E-46
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 20 182 3.0E-46
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 22 182 4.0E-46
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 22 214 5.0E-46
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 22 214 3.0E-45
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 22 214 3.0E-45
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 22 182 6.0E-45
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 19 203 8.0E-45
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 22 214 1.0E-44
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 19 204 2.0E-44
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 14 214 6.0E-44
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 19 196 1.0E-43
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 22 181 1.0E-42
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 22 203 2.0E-42
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 7 177 2.0E-42
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 22 214 7.0E-42
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 22 214 8.0E-42
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 1 181 8.0E-42
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 22 214 2.0E-41
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 22 194 2.0E-41
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 22 194 2.0E-41
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 22 194 2.0E-41
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 19 182 2.0E-41
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 22 214 2.0E-41
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 22 192 3.0E-41
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 22 194 3.0E-41
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 22 214 3.0E-41
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 19 182 3.0E-41
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 22 214 4.0E-41
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 22 192 5.0E-41
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 22 192 5.0E-41
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 22 192 5.0E-41
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 22 192 5.0E-41
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 22 192 5.0E-41
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 22 181 6.0E-41
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 22 188 9.0E-41
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 22 188 9.0E-41
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 22 188 9.0E-41
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 22 177 1.0E-40
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 22 194 1.0E-40
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 22 182 1.0E-40
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 22 192 1.0E-40
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 22 214 1.0E-40
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 22 199 1.0E-40
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 22 199 1.0E-40
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 22 199 1.0E-40
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 22 199 1.0E-40
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 22 212 2.0E-40
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 22 178 2.0E-40
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 22 195 2.0E-40
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 19 182 2.0E-40
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 22 212 2.0E-40
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 22 214 3.0E-40
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 22 207 3.0E-40
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 22 178 3.0E-40
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 20 181 3.0E-40
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 22 178 3.0E-40
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 22 178 4.0E-40
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 22 178 4.0E-40
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 22 204 4.0E-40
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 22 212 4.0E-40
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 22 212 4.0E-40
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 7 174 5.0E-40
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 22 199 5.0E-40
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 22 181 6.0E-40
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 22 214 7.0E-40
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 22 195 8.0E-40
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 22 214 8.0E-40
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 22 195 9.0E-40
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 22 195 9.0E-40
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 22 195 9.0E-40
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 22 195 9.0E-40
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 22 180 1.0E-39
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 22 195 1.0E-39
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 22 182 1.0E-39
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 22 195 1.0E-39
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 22 181 1.0E-39
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 22 176 1.0E-39
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 22 177 1.0E-39
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 22 187 1.0E-39
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 22 187 1.0E-39
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 22 181 2.0E-39
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 22 214 2.0E-39
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 22 174 2.0E-39
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 22 212 2.0E-39
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 22 212 2.0E-39
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 22 177 2.0E-39
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 22 184 2.0E-39
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 22 212 2.0E-39
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 22 213 2.0E-39
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 22 199 3.0E-39
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 22 178 3.0E-39
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 22 175 3.0E-39
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 22 181 3.0E-39
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 22 196 3.0E-39
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 22 195 3.0E-39
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 22 177 3.0E-39
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 22 181 4.0E-39
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 22 199 4.0E-39
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 22 200 4.0E-39
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 22 181 4.0E-39
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 22 214 4.0E-39
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 22 214 4.0E-39
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 22 214 4.0E-39
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 22 174 4.0E-39
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 22 178 5.0E-39
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 22 174 5.0E-39
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 22 174 5.0E-39
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 22 199 5.0E-39
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 22 181 6.0E-39
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 22 177 6.0E-39
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 22 212 6.0E-39
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 22 204 6.0E-39
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 22 178 6.0E-39
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 22 181 6.0E-39
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 22 195 7.0E-39
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 22 177 8.0E-39
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 22 177 8.0E-39
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 22 181 8.0E-39
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 22 181 8.0E-39
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 22 181 1.0E-38
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 22 181 1.0E-38
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 21 189 1.0E-38
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 22 194 1.0E-38
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 22 214 1.0E-38
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 22 214 1.0E-38
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 22 181 1.0E-38
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 22 174 1.0E-38
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 22 177 1.0E-38
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 22 182 2.0E-38
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 22 177 2.0E-38
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 22 214 2.0E-38
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 22 214 2.0E-38
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 22 214 2.0E-38
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 22 174 2.0E-38
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 22 214 2.0E-38
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 22 214 2.0E-38
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 22 187 3.0E-38
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 22 181 3.0E-38
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 22 181 3.0E-38
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 22 177 3.0E-38
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 22 174 3.0E-38
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 15 212 3.0E-38
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 22 174 3.0E-38
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 22 181 4.0E-38
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 22 177 4.0E-38
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 22 214 4.0E-38
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 22 214 4.0E-38
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 22 214 4.0E-38
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 22 214 4.0E-38
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 22 214 5.0E-38
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 22 214 5.0E-38
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 22 214 5.0E-38
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 22 214 5.0E-38
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 22 214 5.0E-38
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 22 214 5.0E-38
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 22 174 5.0E-38
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 22 177 5.0E-38
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 22 212 5.0E-38
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 22 177 5.0E-38
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 22 177 5.0E-38
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 22 204 6.0E-38
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 22 199 6.0E-38
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 22 174 6.0E-38
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 22 178 8.0E-38
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 22 188 1.0E-37
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 22 188 1.0E-37
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 22 188 1.0E-37
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 22 178 1.0E-37
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 22 178 1.0E-37
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 22 174 1.0E-37
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 22 178 1.0E-37
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 22 178 1.0E-37
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 22 178 1.0E-37
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 22 177 1.0E-37
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 22 191 1.0E-37
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 22 212 1.0E-37
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 22 181 1.0E-37
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 22 174 2.0E-37
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 22 178 2.0E-37
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 19 214 2.0E-37
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 17 214 2.0E-37
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 22 181 2.0E-37
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 22 178 2.0E-37
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 22 214 2.0E-37
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 22 212 2.0E-37
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 22 212 2.0E-37
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 22 212 2.0E-37
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 22 181 2.0E-37
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 22 212 2.0E-37
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 22 178 2.0E-37
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 22 199 3.0E-37
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 22 177 3.0E-37
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 22 177 3.0E-37
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 22 177 3.0E-37
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 22 204 3.0E-37
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 22 177 4.0E-37
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 22 212 4.0E-37
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 22 178 6.0E-37
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 22 177 6.0E-37
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 1 199 6.0E-37
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 22 177 8.0E-37
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 22 177 9.0E-37
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 22 177 9.0E-37
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 22 178 1.0E-36
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 22 212 1.0E-36
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 22 177 1.0E-36
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 11 177 1.0E-36
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 22 191 1.0E-36
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 22 174 2.0E-36
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 22 190 2.0E-36
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 22 178 2.0E-36
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 11 177 2.0E-36
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 27 214 2.0E-36
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 22 177 2.0E-36
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 22 190 2.0E-36
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 22 177 3.0E-36
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 22 177 3.0E-36
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 22 177 3.0E-36
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 5 178 3.0E-36
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 22 177 3.0E-36
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 22 190 3.0E-36
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 22 190 3.0E-36
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 22 190 3.0E-36
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 5 181 4.0E-36
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 22 214 4.0E-36
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 22 212 5.0E-36
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 22 210 5.0E-36
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 22 177 5.0E-36
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 22 177 6.0E-36
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 22 177 6.0E-36
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 22 177 6.0E-36
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 22 177 6.0E-36
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 22 177 6.0E-36
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 22 177 6.0E-36
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 22 177 6.0E-36
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 22 177 6.0E-36
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 22 214 7.0E-36
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 22 195 8.0E-36
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 22 177 9.0E-36
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 22 214 9.0E-36
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 22 177 1.0E-35
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 22 177 1.0E-35
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 22 174 1.0E-35
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 22 174 1.0E-35
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 22 174 1.0E-35
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 22 174 1.0E-35
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 22 177 1.0E-35
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 22 177 2.0E-35
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 22 174 2.0E-35
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 22 190 2.0E-35
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 22 184 3.0E-35
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 22 214 4.0E-35
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 22 214 4.0E-35
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 22 207 4.0E-35
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 22 177 4.0E-35
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 22 188 4.0E-35
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 22 214 4.0E-35
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 22 212 5.0E-35
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 22 212 6.0E-35
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 22 178 6.0E-35
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 16 214 7.0E-35
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 22 177 8.0E-35
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 22 205 9.0E-35
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 22 202 9.0E-35
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 22 174 9.0E-35
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 14 185 9.0E-35
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 8 177 1.0E-34
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 19 181 1.0E-34
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 18 181 2.0E-34
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 22 212 2.0E-34
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 4 177 2.0E-34
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 8 177 2.0E-34
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 5 178 2.0E-34
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 22 214 3.0E-34
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 22 174 3.0E-34
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 22 214 4.0E-34
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 9 185 5.0E-34
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 22 214 5.0E-34
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 22 214 6.0E-34
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 22 214 6.0E-34
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 22 181 8.0E-34
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 22 214 8.0E-34
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 19 174 8.0E-34
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 22 214 1.0E-33
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 22 181 1.0E-33
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 22 178 1.0E-33
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 20 178 1.0E-33
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 22 214 2.0E-33
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 22 196 2.0E-33
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 22 187 2.0E-33
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 22 185 2.0E-33
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 22 214 2.0E-33
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 22 214 3.0E-33
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 22 187 3.0E-33
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 22 212 3.0E-33
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 22 202 3.0E-33
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 22 187 4.0E-33
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 22 212 4.0E-33
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 17 181 4.0E-33
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 22 187 4.0E-33
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 17 181 5.0E-33
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 22 214 5.0E-33
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 22 214 6.0E-33
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 17 181 6.0E-33
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 22 212 1.0E-32
sp|Q99P74|RB27B_RAT Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 22 214 1.0E-32
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 19 178 1.0E-32
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 22 197 1.0E-32
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 22 214 1.0E-32
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 18 178 2.0E-32
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 22 214 3.0E-32
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 17 181 3.0E-32
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 22 174 3.0E-32
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 19 178 4.0E-32
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 22 181 5.0E-32
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 22 214 6.0E-32
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 19 178 7.0E-32
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 19 178 7.0E-32
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 22 178 8.0E-32
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 19 178 9.0E-32
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 22 178 9.0E-32
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 22 171 1.0E-31
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 22 214 1.0E-31
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 22 170 1.0E-31
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 8 196 1.0E-31
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 22 212 1.0E-31
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 22 191 2.0E-31
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 22 170 3.0E-31
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 22 170 5.0E-31
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 14 178 5.0E-31
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 22 170 6.0E-31
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 22 196 6.0E-31
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 22 214 1.0E-30
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 22 214 1.0E-30
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 22 212 1.0E-30
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 22 214 2.0E-30
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 22 170 2.0E-30
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 22 212 2.0E-30
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 22 212 3.0E-30
sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 10 212 3.0E-30
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 20 214 3.0E-30
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 22 212 4.0E-30
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 22 178 5.0E-30
sp|Q20365|RAB33_CAEEL Ras-related protein Rab-33 OS=Caenorhabditis elegans GN=rab-33 PE=2 SV=1 19 195 7.0E-30
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 17 178 8.0E-30
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 23 181 8.0E-30
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 22 187 1.0E-29
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 22 212 1.0E-29
sp|Q54P07|RB32D_DICDI Ras-related protein Rab-32D OS=Dictyostelium discoideum GN=rab32D PE=3 SV=1 19 171 1.0E-29
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 19 170 2.0E-29
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 2 185 2.0E-29
sp|Q12829|RB40B_HUMAN Ras-related protein Rab-40B OS=Homo sapiens GN=RAB40B PE=2 SV=1 5 178 3.0E-29
sp|P0C0E4|RB40L_HUMAN Ras-related protein Rab-40A-like OS=Homo sapiens GN=RAB40AL PE=1 SV=1 1 178 6.0E-29
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 14 214 6.0E-29
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 19 170 7.0E-29
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 22 212 7.0E-29
sp|Q8VHP8|RB40B_MOUSE Ras-related protein Rab-40B OS=Mus musculus GN=Rab40b PE=2 SV=1 5 178 8.0E-29
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 22 138 1.0E-28
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 22 174 1.0E-28
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 22 138 1.0E-28
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 22 174 2.0E-28
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 22 174 2.0E-28
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 22 174 2.0E-28
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 22 138 2.0E-28
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 22 138 2.0E-28
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 22 170 2.0E-28
sp|Q8WXH6|RB40A_HUMAN Ras-related protein Rab-40A OS=Homo sapiens GN=RAB40A PE=2 SV=2 1 178 2.0E-28
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 22 212 4.0E-28
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 22 195 5.0E-28
sp|P35290|RAB24_MOUSE Ras-related protein Rab-24 OS=Mus musculus GN=Rab24 PE=1 SV=2 22 178 5.0E-28
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 16 214 8.0E-28
sp|Q55FU9|RAB24_DICDI Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 22 178 9.0E-28
sp|Q969Q5|RAB24_HUMAN Ras-related protein Rab-24 OS=Homo sapiens GN=RAB24 PE=1 SV=1 22 178 9.0E-28
sp|Q96S21|RB40C_HUMAN Ras-related protein Rab-40C OS=Homo sapiens GN=RAB40C PE=1 SV=1 22 186 1.0E-27
sp|Q8VHQ4|RB40C_MOUSE Ras-related protein Rab-40C OS=Mus musculus GN=Rab40c PE=1 SV=1 22 186 1.0E-27
sp|P57729|RAB38_HUMAN Ras-related protein Rab-38 OS=Homo sapiens GN=RAB38 PE=1 SV=1 16 136 3.0E-27
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 15 174 5.0E-27
sp|Q8QZZ8|RAB38_MOUSE Ras-related protein Rab-38 OS=Mus musculus GN=Rab38 PE=1 SV=1 22 136 8.0E-27
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 22 174 3.0E-26
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 22 195 3.0E-26
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 22 174 4.0E-26
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 22 174 4.0E-26
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 22 174 4.0E-26
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 22 174 4.0E-26
sp|Q54QR3|RB32A_DICDI Ras-related protein Rab-32A OS=Dictyostelium discoideum GN=rab32A PE=1 SV=1 22 171 4.0E-26
sp|Q54SV1|RABY_DICDI Ras-related protein RabY OS=Dictyostelium discoideum GN=rabY PE=3 SV=1 22 174 8.0E-26
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 22 195 8.0E-26
sp|Q54G48|RABO_DICDI Ras-related protein RabO OS=Dictyostelium discoideum GN=rabO PE=3 SV=1 22 178 9.0E-26
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 19 212 1.0E-25
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 22 174 2.0E-25
sp|Q9CZE3|RAB32_MOUSE Ras-related protein Rab-32 OS=Mus musculus GN=Rab32 PE=1 SV=3 10 136 5.0E-25
sp|Q13637|RAB32_HUMAN Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3 22 203 7.0E-25
sp|Q9D0P8|IFT27_MOUSE Intraflagellar transport protein 27 homolog OS=Mus musculus GN=Ift27 PE=1 SV=1 22 187 1.0E-24
sp|Q06AU5|RAB32_PIG Ras-related protein Rab-32 OS=Sus scrofa GN=RAB32 PE=2 SV=1 22 136 1.0E-24
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 2 183 1.0E-24
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 2 183 1.0E-24
sp|Q7F7I7|RAN1_ORYSJ GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1 22 183 2.0E-24
sp|A2WSI7|RAN1_ORYSI GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2 22 183 2.0E-24
sp|P54766|RAN1B_LOTJA GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1 22 183 2.0E-24
sp|P54765|RAN1A_LOTJA GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1 22 183 2.0E-24
sp|Q0VCN3|IFT27_BOVIN Intraflagellar transport protein 27 homolog OS=Bos taurus GN=IFT27 PE=2 SV=1 22 187 2.0E-24
sp|P41918|RANA1_TOBAC GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1 22 183 3.0E-24
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 22 178 3.0E-24
sp|Q8H156|RAN3_ARATH GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2 22 183 3.0E-24
sp|P38546|RAN1_SOLLC GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1 22 183 3.0E-24
sp|P38547|RAN2_SOLLC GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1 22 183 3.0E-24
sp|P41919|RANB1_TOBAC GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1 22 183 4.0E-24
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 22 183 4.0E-24
sp|P38548|RAN_VICFA GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1 22 183 4.0E-24
sp|P41916|RAN1_ARATH GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 22 183 5.0E-24
sp|P51157|RAB28_HUMAN Ras-related protein Rab-28 OS=Homo sapiens GN=RAB28 PE=1 SV=2 19 185 6.0E-24
sp|P32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP1 PE=1 SV=1 22 208 1.0E-23
sp|Q3SWY9|RAB28_BOVIN Ras-related protein Rab-28 OS=Bos taurus GN=RAB28 PE=2 SV=1 19 185 1.0E-23
sp|Q7GD79|RAN2_ORYSJ GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1 22 183 1.0E-23
sp|A2Y7R5|RAN2_ORYSI GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1 22 183 1.0E-23
sp|P32836|GSP2_YEAST GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP2 PE=1 SV=1 22 208 1.0E-23
sp|Q5RFI2|RAB28_PONAB Ras-related protein Rab-28 OS=Pongo abelii GN=RAB28 PE=2 SV=1 19 185 1.0E-23
sp|Q6IMK3|DJC27_DANRE DnaJ homolog subfamily C member 27 OS=Danio rerio GN=dnajc27 PE=2 SV=1 20 184 1.0E-23
sp|Q9BW83|IFT27_HUMAN Intraflagellar transport protein 27 homolog OS=Homo sapiens GN=IFT27 PE=1 SV=1 21 187 2.0E-23
sp|Q74ZA9|GSP1_ASHGO GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSP1 PE=3 SV=1 22 208 2.0E-23
sp|Q99KL7|RAB28_MOUSE Ras-related protein Rab-28 OS=Mus musculus GN=Rab28 PE=1 SV=1 19 185 2.0E-23
sp|Q9VUN3|RANL_DROME GTP-binding nuclear protein Ran-like OS=Drosophila melanogaster GN=Ran-like PE=1 SV=1 22 183 3.0E-23
sp|P51158|RAB28_RAT Ras-related protein Rab-28 OS=Rattus norvegicus GN=Rab28 PE=2 SV=1 19 185 4.0E-23
sp|Q55E31|RB32B_DICDI Ras-related protein Rab-32B OS=Dictyostelium discoideum GN=rab32B PE=3 SV=1 22 138 4.0E-23
sp|O17915|RAN_CAEEL GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans GN=ran-1 PE=1 SV=1 22 183 5.0E-23
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 22 183 8.0E-23
sp|Q5RDE5|DJC27_PONAB DnaJ homolog subfamily C member 27 OS=Pongo abelii GN=DNAJC27 PE=2 SV=1 20 181 9.0E-23
sp|Q5M7D1|DJ27B_XENLA DnaJ homolog subfamily C member 27-B OS=Xenopus laevis GN=dnajc27-b PE=2 SV=1 15 181 9.0E-23
sp|Q9NZQ0|DJC27_HUMAN DnaJ homolog subfamily C member 27 OS=Homo sapiens GN=DNAJC27 PE=1 SV=1 20 181 1.0E-22
sp|Q7ZYF1|DJ27A_XENLA DnaJ homolog subfamily C member 27-A OS=Xenopus laevis GN=dnajc27-a PE=2 SV=1 20 175 1.0E-22
sp|P52301|RAN_XENLA GTP-binding nuclear protein Ran OS=Xenopus laevis GN=ran PE=1 SV=2 17 183 1.0E-22
sp|Q9VZ23|RAN_DROME GTP-binding nuclear protein Ran OS=Drosophila melanogaster GN=Ran PE=1 SV=1 22 183 1.0E-22
sp|Q6IML7|DJC27_RAT DnaJ homolog subfamily C member 27 OS=Rattus norvegicus GN=Dnajc27 PE=2 SV=1 20 181 1.0E-22
sp|Q6GL85|RAN_XENTR GTP-binding nuclear protein Ran OS=Xenopus tropicalis GN=ran PE=2 SV=1 17 183 1.0E-22
sp|P42558|RAN_CHICK GTP-binding nuclear protein Ran OS=Gallus gallus GN=RAN PE=2 SV=1 17 183 1.0E-22
sp|P62828|RAN_RAT GTP-binding nuclear protein Ran OS=Rattus norvegicus GN=Ran PE=1 SV=3 17 183 1.0E-22
sp|Q5R556|RAN_PONAB GTP-binding nuclear protein Ran OS=Pongo abelii GN=RAN PE=2 SV=3 17 183 1.0E-22
sp|P62827|RAN_MOUSE GTP-binding nuclear protein Ran OS=Mus musculus GN=Ran PE=1 SV=3 17 183 1.0E-22
sp|Q4R4M9|RAN_MACFA GTP-binding nuclear protein Ran OS=Macaca fascicularis GN=RAN PE=2 SV=3 17 183 1.0E-22
sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 17 183 1.0E-22
sp|P62825|RAN_CANLF GTP-binding nuclear protein Ran OS=Canis lupus familiaris GN=RAN PE=1 SV=3 17 183 1.0E-22
sp|Q3T054|RAN_BOVIN GTP-binding nuclear protein Ran OS=Bos taurus GN=RAN PE=2 SV=3 17 183 1.0E-22
sp|P41915|RAN_TETTH GTP-binding nuclear protein Ran OS=Tetrahymena thermophila PE=2 SV=1 22 183 2.0E-22
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 22 195 2.0E-22
sp|P79735|RAN_DANRE GTP-binding nuclear protein Ran OS=Danio rerio GN=ran PE=2 SV=1 14 183 2.0E-22
sp|P38542|RAN_BRUMA GTP-binding nuclear protein Ran OS=Brugia malayi GN=Bm1_44725 PE=2 SV=2 22 183 2.0E-22
sp|Q9YGC0|RAN_SALSA GTP-binding nuclear protein Ran OS=Salmo salar GN=ran PE=2 SV=1 17 183 2.0E-22
sp|Q7ZZX9|RAN_CARAU GTP-binding nuclear protein Ran OS=Carassius auratus GN=ran PE=2 SV=1 17 183 2.0E-22
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 22 204 2.0E-22
sp|Q8MXQ2|RB32C_DICDI Ras-related protein Rab-32C OS=Dictyostelium discoideum GN=rab32C PE=3 SV=2 22 137 2.0E-22
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 19 214 3.0E-22
sp|Q8CFP6|DJC27_MOUSE DnaJ homolog subfamily C member 27 OS=Mus musculus GN=Dnajc27 PE=1 SV=1 20 181 3.0E-22
sp|Q6FR65|GSP1_CANGA GTP-binding nuclear protein GSP1/Ran OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GSP1 PE=3 SV=1 22 208 3.0E-22
sp|Q86JC8|RABH_DICDI Ras-related protein RabH OS=Dictyostelium discoideum GN=rabH PE=3 SV=1 20 174 6.0E-22
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 22 188 9.0E-22
sp|Q6IMM1|DJC27_CHICK DnaJ homolog subfamily C member 27 OS=Gallus gallus GN=DNAJC27 PE=2 SV=1 20 175 9.0E-22
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 3 187 1.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055580
MADPVSSPVAADFSSAPPKRTKIVLLGDQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDRTVRLQLWD
TAGQERFRSLIPSYIRDSSVAIVVFDITNRQSFMSTTKWIEDVRSERGNDVIIVLVGNKADLSDKRQVTLEEATA
KATQLNIMFMETSAKAGHNVKGLFKKIAMSLPGMEKENQSDTNTKIDVTTSSAGEVPEASSCNC*
Coding >AgabiH97|055580
ATGGCCGACCCAGTCTCGTCGCCAGTCGCAGCCGACTTCTCTTCTGCCCCGCCAAAACGCACAAAGATCGTCCTC
CTCGGCGACCAGTCCGTCGGCAAGACAAGTCTCATCACCAGGTTTATGTATGACACGTTTGATAATACATATCAA
GCTACCATTGGTATCGATTTCTTGAGCAAGACAATGTATCTCGAGGACCGCACCGTTCGGCTACAACTCTGGGAC
ACTGCCGGTCAGGAACGCTTTCGTTCTCTGATACCTTCGTACATCCGCGATTCGTCAGTCGCAATCGTCGTGTTC
GATATCACAAATCGACAGTCATTCATGTCCACCACCAAATGGATTGAGGATGTCCGGTCGGAAAGAGGGAATGAT
GTTATAATTGTGCTGGTGGGAAACAAGGCAGATCTTTCAGATAAGCGGCAAGTTACGCTGGAAGAAGCAACTGCA
AAGGCAACGCAGCTCAATATCATGTTCATGGAAACCTCAGCAAAGGCAGGGCATAATGTCAAGGGTCTATTCAAG
AAAATAGCCATGTCGTTACCTGGTATGGAGAAGGAAAATCAATCAGACACTAATACGAAAATTGACGTCACAACG
TCATCGGCGGGCGAGGTGCCCGAGGCATCTTCATGCAACTGTTGA
Transcript >AgabiH97|055580
ATGGCCGACCCAGTCTCGTCGCCAGTCGCAGCCGACTTCTCTTCTGCCCCGCCAAAACGCACAAAGATCGTCCTC
CTCGGCGACCAGTCCGTCGGCAAGACAAGTCTCATCACCAGGTTTATGTATGACACGTTTGATAATACATATCAA
GCTACCATTGGTATCGATTTCTTGAGCAAGACAATGTATCTCGAGGACCGCACCGTTCGGCTACAACTCTGGGAC
ACTGCCGGTCAGGAACGCTTTCGTTCTCTGATACCTTCGTACATCCGCGATTCGTCAGTCGCAATCGTCGTGTTC
GATATCACAAATCGACAGTCATTCATGTCCACCACCAAATGGATTGAGGATGTCCGGTCGGAAAGAGGGAATGAT
GTTATAATTGTGCTGGTGGGAAACAAGGCAGATCTTTCAGATAAGCGGCAAGTTACGCTGGAAGAAGCAACTGCA
AAGGCAACGCAGCTCAATATCATGTTCATGGAAACCTCAGCAAAGGCAGGGCATAATGTCAAGGGTCTATTCAAG
AAAATAGCCATGTCGTTACCTGGTATGGAGAAGGAAAATCAATCAGACACTAATACGAAAATTGACGTCACAACG
TCATCGGCGGGCGAGGTGCCCGAGGCATCTTCATGCAACTGTTGA
Gene >AgabiH97|055580
ATGGCCGACCCAGTCTCGTCGCCAGTCGCAGCCGACTTCTCTTCTGCCCCGCCAAAACGCACAAAGATCGTCCTC
CTCGGCGACCAGTCCGTCGGCAAGACAAGTCTCATCACCAGGTCCGTCTGCCCCAGCCAAGTCTTCTCATTTACC
TCACCGCACCCAGGTTTATGTATGACACGTTTGATAATACATATCAAGCTACCATTGGTATCGATTTCTTGAGCA
AGACAATGTATCTCGAGGACCGCACCGTTCGGCTACAACTCTGGGACACTGCCGGTCAGGTATAGACGTCCCTTC
CTCTACCGAGGCGTCCCTCCACCAACATCCTCTGTTTTAGGAACGCTTTCGTTCTCTGATACCTTCGTACATCCG
CGATTCGTCAGTCGCAATCGTCGTGTTCGATATCACAAGCAAGTCCTTGTCTCCGACTCTCCGCCCACGTTTCTA
TGTCTGACGTGTAACTAGATCGACAGTCATTCATGTCCACCACCAAATGGATTGAGGATGTCCGGTCGGAAAGAG
GGAATGATGTTATAATTGTGCTGGTGGGAAACAAGGCAGATCTTTCAGATAAGCGGTGCGTCTCCAGCTTACTTT
TCAGTTCTGGTATTATAAATATGGTTACAGGCAAGTTACGCTGGAAGAAGCAACTGCAAAGGCAACGCAGCTCAA
TATCATGTTCATGGAAACCTCAGCAAAGGCAGGGCATAATGTCAAGGGTCTATTCAAGAAAATAGCCATGTCGTT
ACCTGGTATGGAGAAGGAAAATCAATCAGACACTAATACGAGTGCGTTTCCCGCTCCAATGTTACCGTTGGACTA
TGCTTTTGACACGCCTGTGCTGCAGAAATTGACGTCACAACGTCATCGGCGGGCGAGGTGCCCGAGGCATCTTCA
TGCAACTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail