Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055480
Gene name
Locationscaffold_3:707407..709001
Strand+
Gene length (bp)1594
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 1.8E-33 118 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CYK2|QPCT_MOUSE Glutaminyl-peptide cyclotransferase OS=Mus musculus GN=Qpct PE=1 SV=2 68 383 5.0E-70
sp|Q16769|QPCT_HUMAN Glutaminyl-peptide cyclotransferase OS=Homo sapiens GN=QPCT PE=1 SV=1 68 383 2.0E-68
sp|Q90YA8|QPCT_GLOBL Glutaminyl-peptide cyclotransferase OS=Gloydius blomhoffii GN=QPCT PE=2 SV=1 11 383 9.0E-68
sp|A7ISW1|QPCT_BOIIR Glutaminyl-peptide cyclotransferase OS=Boiga irregularis GN=QPCT PE=2 SV=1 11 383 4.0E-67
sp|Q0V8G3|QPCTL_BOVIN Glutaminyl-peptide cyclotransferase-like protein OS=Bos taurus GN=QPCTL PE=2 SV=1 65 383 7.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CYK2|QPCT_MOUSE Glutaminyl-peptide cyclotransferase OS=Mus musculus GN=Qpct PE=1 SV=2 68 383 5.0E-70
sp|Q16769|QPCT_HUMAN Glutaminyl-peptide cyclotransferase OS=Homo sapiens GN=QPCT PE=1 SV=1 68 383 2.0E-68
sp|Q90YA8|QPCT_GLOBL Glutaminyl-peptide cyclotransferase OS=Gloydius blomhoffii GN=QPCT PE=2 SV=1 11 383 9.0E-68
sp|A7ISW1|QPCT_BOIIR Glutaminyl-peptide cyclotransferase OS=Boiga irregularis GN=QPCT PE=2 SV=1 11 383 4.0E-67
sp|Q0V8G3|QPCTL_BOVIN Glutaminyl-peptide cyclotransferase-like protein OS=Bos taurus GN=QPCTL PE=2 SV=1 65 383 7.0E-67
sp|A7ISW2|QPCT_BOIDE Glutaminyl-peptide cyclotransferase OS=Boiga dendrophila GN=QPCT PE=2 SV=1 11 383 8.0E-67
sp|Q28120|QPCT_BOVIN Glutaminyl-peptide cyclotransferase OS=Bos taurus GN=QPCT PE=1 SV=1 68 383 1.0E-64
sp|Q8BH73|QPCTL_MOUSE Glutaminyl-peptide cyclotransferase-like protein OS=Mus musculus GN=Qpctl PE=1 SV=1 65 383 3.0E-64
sp|Q9YIB5|QPCT_BOTJA Glutaminyl-peptide cyclotransferase OS=Bothrops jararaca GN=QPCT PE=2 SV=1 11 383 8.0E-64
sp|Q4R942|QPCTL_MACFA Glutaminyl-peptide cyclotransferase-like protein OS=Macaca fascicularis GN=QPCTL PE=2 SV=1 58 383 2.0E-61
sp|Q9NXS2|QPCTL_HUMAN Glutaminyl-peptide cyclotransferase-like protein OS=Homo sapiens GN=QPCTL PE=1 SV=2 58 383 4.0E-60
sp|Q54B14|QPCT_DICDI Glutaminyl-peptide cyclotransferase OS=Dictyostelium discoideum GN=qpct PE=3 SV=1 14 381 4.0E-58
sp|P43599|YFI8_YEAST Uncharacterized protein YFR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFR018C PE=1 SV=1 63 386 7.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055480
MPSWLFGCCRVSLFCALWCLASTFLSLQASVLGERDLPQLSSDELSVLVTGVPDPILKLDPANPNSHLSKILIPR
APGTENITLVRNYIVSTLKNLNWEVEVDEFTDETPIGKKRFANIIATKDPSASRRLVLSAHYDSKWFPDYPQNQF
VGATDSAAPCAFMLDIAETLNPLLEDRMKRFEEGLIEEDDDDDIDDMTLQLVFFDGEEAFHSWTDTDSIYGARHL
AQKWARTYRQHTKRRLLSVQETEISAVEHLILLDLLGAPNPLIKSYFADTRWMFDALVRIEQRLGDSGAFEYGEE
KSMAPDSWQSWFLSRQNMNLGFGYLGDDHVPFLRQGVSVLHVIADPFPKVWHKLGDDRAALDLPTMRRWSLILRV
FLSEYLHLRPEVSGKGAESPSENLTPQPESRRYDKNISEL*
Coding >AgabiH97|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCTCAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCCTGGCACCGAAAACATTACCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTC
GAAGTAGATGAATTCACTGACGAGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAAGATCCC
TCTGCGTCTCGTCGACTTGTTCTATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGTTT
GTTGGCGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGACATTGCAGAAACTCTCAATCCACTTTTGGAA
GACCGTATGAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGATGACGATGACATTGACGATATGACTCTGCAA
CTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGACACAGATTCCATCTATGGTGCGCGACACCTT
GCACAAAAATGGGCACGAACCTATCGTCAACACACGAAGCGACGTCTATTGAGCGTACAGGAAACTGAAATATCT
GCCGTAGAACACCTTATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATACTTTGCCGACACT
AGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGAATACGGAGAGGAA
AAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGGGTTTGGCTATCTC
GGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCCTTTCCCCAAAGTA
TGGCATAAATTGGGGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCATTCTCCGGGTT
TTCTTATCGGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAACG
CCACAACCGGAGTCCCGTCGATATGACAAAAACATCTCGGAATTGTAG
Transcript >AgabiH97|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCTCAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCCTGGCACCGAAAACATTACCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTC
GAAGTAGATGAATTCACTGACGAGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAAGATCCC
TCTGCGTCTCGTCGACTTGTTCTATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGTTT
GTTGGCGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGACATTGCAGAAACTCTCAATCCACTTTTGGAA
GACCGTATGAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGATGACGATGACATTGACGATATGACTCTGCAA
CTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGACACAGATTCCATCTATGGTGCGCGACACCTT
GCACAAAAATGGGCACGAACCTATCGTCAACACACGAAGCGACGTCTATTGAGCGTACAGGAAACTGAAATATCT
GCCGTAGAACACCTTATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATACTTTGCCGACACT
AGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGAATACGGAGAGGAA
AAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGGGTTTGGCTATCTC
GGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCCTTTCCCCAAAGTA
TGGCATAAATTGGGGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCATTCTCCGGGTT
TTCTTATCGGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAACG
CCACAACCGGAGTCCCGTCGATATGACAAAAACATCTCGGAATTGTAG
Gene >AgabiH97|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCTCAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCGTGAGTTGCTGTGTTATCTCTCAAGGTTACTCCGAATTGAACCGGGCATACAGCTGGCACCGAAAACATTA
CCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTCGAAGTAGATGAATTCACTGACG
AGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAAGATCCCTCTGCGTCTCGTCGACTTGTTC
TATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGGTTCGTGGTCAAAAATTCAAACTTA
TGCATGCATGGCTCAAATATGCCTCCAGTTTGTTGGCGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGA
CATTGCAGAAACTCTCAATCCACTTTTGGAAGACCGTATGAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGA
TGACGATGACATTGACGATATGACTCTGCAACTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGA
CACAGATTCCATCTATGGTGCGCGGTATGGAATATTTATTCTCATCCGGGATTGAGACCTTTAGTGAACTTCTAA
AATTAGACACCTTGCACAAAAATGGGCACGAACCTATCGTCAACACACGAAGCGACGTCTATTGAGCGTACAGGA
AACTGAAATATCTGCCGTAGAACACCTTATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATA
CTTTGCCGACACTAGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGA
ATACGGAGAGGAAAAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGG
GTTTGGCTATCTCGGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCC
TTTCCCCAAAGTATGGCATAAATTGGGGGTGAGCTACGGCACGCAGAGTCTCGAATTTTTTTCTAACATAGGCGT
ACTATAGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCATTCTCCGGGTTTTCTTATC
GGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAGTAAGTCGTAT
GACCGGTCTCTGGCCAATGCTGTATGTACTAACTAACACTAACCTCTACCCGAGCCAGACGCCACAACCGGAGTC
CCGTCGATATGACAAAAACATCTCGGAATTGGTGAGAAACTTTCTACGGCCTTGAGTTTTGAGCACTGAATCTGA
TTATTTCTTCGTCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail