Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055410
Gene name
Locationscaffold_3:693164..693918
Strand-
Gene length (bp)754
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.1E-37 7 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 201 3.0E-17
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 6 160 3.0E-15
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 5 97 7.0E-15
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 6 94 7.0E-15
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 6 203 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 201 3.0E-17
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 6 160 3.0E-15
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 5 97 7.0E-15
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 6 94 7.0E-15
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 6 203 1.0E-14
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 6 201 4.0E-14
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 1 95 4.0E-13
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 9 95 5.0E-13
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 9 95 6.0E-13
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 6 160 7.0E-13
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 6 160 7.0E-13
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 7 212 3.0E-12
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 6 160 3.0E-12
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 9 141 4.0E-12
sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1 9 95 4.0E-12
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 6 160 5.0E-12
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 6 160 6.0E-12
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 6 160 7.0E-12
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 9 163 9.0E-12
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 6 160 9.0E-12
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 6 159 1.0E-11
sp|B1JL20|GPMB_YERPY Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q66EU3|GPMB_YERPS Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A4TQH5|GPMB_YERPP Probable phosphoglycerate mutase GpmB OS=Yersinia pestis (strain Pestoides F) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q1CMX2|GPMB_YERPN Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A9R032|GPMB_YERPG Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q8ZIP0|GPMB_YERPE Probable phosphoglycerate mutase GpmB OS=Yersinia pestis GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B2K3K5|GPMB_YERPB Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q1C0L5|GPMB_YERPA Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A7FMF8|GPMB_YERP3 Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 9 158 2.0E-11
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 6 160 5.0E-11
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 6 160 5.0E-11
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 5 126 5.0E-11
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 6 160 6.0E-11
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 6 160 8.0E-11
sp|P58652|COBC_SALTI Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhi GN=cobC PE=3 SV=1 6 160 1.0E-10
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 6 175 1.0E-10
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 6 160 2.0E-10
sp|B7J2L3|GPMA_BORBZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ZS7) GN=gpmA PE=3 SV=1 6 125 4.0E-10
sp|O51602|GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gpmA PE=1 SV=2 6 125 4.0E-10
sp|B2S101|GPMA_BORHD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia hermsii (strain HS1 / DAH) GN=gpmA PE=3 SV=1 6 138 4.0E-10
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 6 160 7.0E-10
sp|Q660L2|GPMA_BORBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gpmA PE=3 SV=1 6 125 1.0E-09
sp|P9WIC7|GPGP_MYCTU Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gpgP PE=1 SV=1 6 97 1.0E-09
sp|P9WIC6|GPGP_MYCTO Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gpgP PE=1 SV=1 6 97 1.0E-09
sp|A1R083|GPMA_BORT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia turicatae (strain 91E135) GN=gpmA PE=3 SV=1 6 138 1.0E-09
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 9 181 2.0E-09
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 9 94 2.0E-09
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 9 94 2.0E-09
sp|Q88YY8|GPMA1_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA1 PE=3 SV=1 9 137 5.0E-09
sp|Q0SMJ5|GPMA_BORAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia afzelii (strain PKo) GN=gpmA PE=3 SV=1 6 125 5.0E-09
sp|Q8PST3|GPMA_METMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gpmA PE=3 SV=1 9 167 5.0E-09
sp|A1TC01|GPGP_MYCVP Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=gpgP PE=1 SV=1 6 97 5.0E-09
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 9 94 7.0E-09
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 7 94 1.0E-08
sp|Q29RA5|TIGRA_DANRE Probable fructose-2,6-bisphosphatase TIGAR A OS=Danio rerio GN=tigara PE=2 SV=1 9 94 1.0E-08
sp|Q15SN0|GPMA_PSEA6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmA PE=3 SV=1 9 158 1.0E-08
sp|B5RMK4|GPMA_BORDL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia duttonii (strain Ly) GN=gpmA PE=3 SV=1 6 138 2.0E-08
sp|A6US15|GPMA_METVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gpmA PE=3 SV=1 5 73 2.0E-08
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 6 125 2.0E-08
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 9 94 3.0E-08
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 3 94 3.0E-08
sp|B5RQ00|GPMA_BORRA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia recurrentis (strain A1) GN=gpmA PE=3 SV=1 6 138 3.0E-08
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 3 94 4.0E-08
sp|C5BEL3|GPMA_EDWI9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Edwardsiella ictaluri (strain 93-146) GN=gpmA PE=3 SV=1 6 140 4.0E-08
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 6 170 5.0E-08
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 6 125 6.0E-08
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 9 94 6.0E-08
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 9 94 6.0E-08
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 9 94 8.0E-08
sp|Q7VR80|GPMA_BLOFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia floridanus GN=gpmA PE=3 SV=1 9 178 1.0E-07
sp|Q8A8R2|GPMA1_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA1 PE=3 SV=1 6 188 1.0E-07
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 5 94 2.0E-07
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 9 94 2.0E-07
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 5 94 3.0E-07
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 6 176 4.0E-07
sp|Q64R85|GPMA_BACFR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmA PE=3 SV=1 6 185 4.0E-07
sp|Q5LAT7|GPMA_BACFN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmA PE=3 SV=1 6 185 4.0E-07
sp|Q1MMY4|GPMA_RHIL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gpmA PE=3 SV=1 9 94 5.0E-07
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 9 94 6.0E-07
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 6 126 6.0E-07
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 6 126 6.0E-07
sp|Q21YW0|GPMA_RHOFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpmA PE=3 SV=1 6 125 6.0E-07
sp|B5FP39|GPMA_SALDC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella dublin (strain CT_02021853) GN=gpmA PE=3 SV=1 5 140 9.0E-07
sp|A6T6I3|GPMA_KLEP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B5XZB2|GPMA_KLEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae (strain 342) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|Q8Z8B2|GPMA_SALTI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhi GN=gpmA PE=3 SV=3 5 140 1.0E-06
sp|B4TQR7|GPMA_SALSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|C0PWW0|GPMA_SALPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi C (strain RKS4594) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B4SZH5|GPMA_SALNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella newport (strain SL254) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|Q57RI5|GPMA_SALCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|Q8ZQS2|GPMA_SALTY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmA PE=3 SV=3 5 140 1.0E-06
sp|A9MTL3|GPMA_SALPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B4TC26|GPMA_SALHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella heidelberg (strain SL476) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B5R739|GPMA_SALG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B5QX43|GPMA_SALEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B5F050|GPMA_SALA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella agona (strain SL483) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|B5BC52|GPMA_SALPK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|Q5PG75|GPMA_SALPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|Q3B5J2|GPMA_CHLL7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpmA PE=3 SV=1 6 125 1.0E-06
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 9 94 1.0E-06
sp|Q2NUK6|GPMA_SODGM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sodalis glossinidius (strain morsitans) GN=gpmA PE=3 SV=1 5 124 1.0E-06
sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 9 189 2.0E-06
sp|Q32IH0|GPMA_SHIDS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q3Z455|GPMA_SHISS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|P62710|GPMA_SHIFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri GN=gpmA PE=3 SV=2 5 140 2.0E-06
sp|Q0T6Y5|GPMA_SHIF8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q324G4|GPMA_SHIBS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B2TUY6|GPMA_SHIB3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7LK04|GPMA_ESCF3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B1LM46|GPMA_ECOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B6I7Q9|GPMA_ECOSE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SE11) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7N9Z7|GPMA_ECOLU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|P62707|GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmA PE=1 SV=2 5 140 2.0E-06
sp|B1IXY1|GPMA_ECOLC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|P62708|GPMA_ECOL6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmA PE=3 SV=2 5 140 2.0E-06
sp|Q0TJU6|GPMA_ECOL5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|A1A8Z8|GPMA_ECOK1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|A7ZY11|GPMA_ECOHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B1X786|GPMA_ECODH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / DH10B) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|C4ZXS6|GPMA_ECOBW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7M6B8|GPMA_ECO8A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O8 (strain IAI1) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7MPN9|GPMA_ECO81 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O81 (strain ED1a) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7NNH7|GPMA_ECO7I 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B5YRF2|GPMA_ECO5E 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|P62709|GPMA_ECO57 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmA PE=3 SV=2 5 140 2.0E-06
sp|B7LAF6|GPMA_ECO55 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain 55989 / EAEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7MGL2|GPMA_ECO45 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B7ULM8|GPMA_ECO27 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q2Y9Z7|GPMA2_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA2 PE=3 SV=1 6 140 2.0E-06
sp|A1K9B9|GPMA_AZOSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azoarcus sp. (strain BH72) GN=gpmA PE=3 SV=1 6 125 2.0E-06
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 9 94 2.0E-06
sp|A7ZJD0|GPMA_ECO24 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B0B8U8|GPMA_CHLT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpmA PE=3 SV=1 9 189 2.0E-06
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 6 186 2.0E-06
sp|P50201|MAS12_AGRRH Agropine synthesis reductase OS=Agrobacterium rhizogenes GN=mas1 PE=3 SV=1 2 151 3.0E-06
sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3 6 138 3.0E-06
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 9 94 3.0E-06
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 9 94 3.0E-06
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 5 125 3.0E-06
sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 5 189 3.0E-06
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 6 141 4.0E-06
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 6 126 4.0E-06
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 9 94 5.0E-06
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 6 195 6.0E-06
sp|A7MIX7|GPMA_CROS8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmA PE=3 SV=1 6 140 6.0E-06
sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 6 144 6.0E-06
sp|Q73M14|GPMA_TREDE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gpmA PE=3 SV=1 6 126 6.0E-06
sp|C5CWV9|GPMA_VARPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Variovorax paradoxus (strain S110) GN=gpmA PE=3 SV=1 6 125 6.0E-06
sp|B9L9H5|GPMA_NAUPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=gpmA PE=3 SV=1 5 94 6.0E-06
sp|A4W897|GPMA_ENT38 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmA PE=3 SV=1 5 140 6.0E-06
sp|Q6D7E3|GPMA_PECAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gpmA PE=3 SV=1 5 127 7.0E-06
sp|A8AJ40|GPMA_CITK8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmA PE=3 SV=1 5 140 8.0E-06
sp|A8GBA2|GPMA_SERP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Serratia proteamaculans (strain 568) GN=gpmA PE=3 SV=1 5 140 8.0E-06
sp|Q821N6|GPMA_CHLCV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila caviae (strain GPIC) GN=gpmA PE=3 SV=1 5 188 8.0E-06
sp|P16290|PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus GN=Pgam2 PE=1 SV=2 6 144 9.0E-06
sp|A1TTW5|GPMA_ACIAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax citrulli (strain AAC00-1) GN=gpmA PE=3 SV=1 6 94 9.0E-06
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 5 124 9.0E-06
sp|Q5HLI0|GPMA_STAEQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmA PE=3 SV=1 1 94 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055410
MPSQARVYLVRHGETDGNRDKIIQGQLDIPLNKIGLEQAARVADVLRVIKFDVALSSDLSRAKETAAAILREQPG
LALQEQEDLRERFMGDLEGQVYGTRLDGRLSTMETGPAFAKRTLTWWRKNIVEYTATMVPREEPYNILAVSHGGF
LGTLVKNLVGTGDLRLVEGVVLASLPNASVSLIEWDGRKGKVIQYGEEGHLRRADRLDQNVDELPI*
Coding >AgabiH97|055410
ATGCCCAGCCAAGCAAGGGTATATCTGGTCCGCCATGGAGAAACCGACGGAAACAGAGATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGACTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGATGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGC
CTAGCCTTGCAGGAACAAGAGGATCTGCGAGAGCGTTTCATGGGCGATCTCGAAGGACAAGTGTATGGAACGAGA
CTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAAACGAACTCTCACCTGGTGGAGAAAAAAT
ATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAATATTCTGGCAGTTTCACATGGAGGGTTT
CTAGGCACGTTGGTGAAAAACTTGGTGGGGACTGGAGATTTAAGACTGGTCGAAGGGGTGGTCTTGGCGTCGCTG
CCCAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAAGGTCATTCAGTATGGAGAAGAAGGACAC
TTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGATTTAG
Transcript >AgabiH97|055410
ATGCCCAGCCAAGCAAGGGTATATCTGGTCCGCCATGGAGAAACCGACGGAAACAGAGATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGACTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGATGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGC
CTAGCCTTGCAGGAACAAGAGGATCTGCGAGAGCGTTTCATGGGCGATCTCGAAGGACAAGTGTATGGAACGAGA
CTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAAACGAACTCTCACCTGGTGGAGAAAAAAT
ATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAATATTCTGGCAGTTTCACATGGAGGGTTT
CTAGGCACGTTGGTGAAAAACTTGGTGGGGACTGGAGATTTAAGACTGGTCGAAGGGGTGGTCTTGGCGTCGCTG
CCCAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAAGGTCATTCAGTATGGAGAAGAAGGACAC
TTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGATTTAG
Gene >AgabiH97|055410
ATGCCCAGCCAAGCAAGGGTATATCTGGTCCGCCATGGAGAAACCGACGGAAACAGAGATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGACTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGATGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGGTGAGCGCTACAGACGACTGTCAGAACCACAAT
TAGACTGTTCGTAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGCCTAGCCTTGCAGGAACAAGAGGATCTGC
GAGAGCGTGTGCGTTGGATTTTTACAGTCGTTCAAGGCTAGGTATCGATATTGATTAAGTGTAGTTCATGGGCGA
TCTCGAAGGACAAGTGTATGGAACGAGACTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAA
ACGAACTCTCACCTGGTGGAGAAAAAATATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAA
TATTCTGGCAGTTTCACATGGAGGGTTTCTAGGCACGTTGGTGAAAAACTTGGTGGGGACTGGAGATTTAAGACT
GGTCGAAGGGGTGGTCTTGGCGTCGCTGCCCAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAA
GGTCATTCAGTATGGAGAAGAAGGACACTTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGAT
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail