Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055380
Gene name
Locationscaffold_3:686412..687573
Strand+
Gene length (bp)1161
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 6.3E-82 4 244
PF00071 Ras Ras family 1.9E-07 4 136
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 7.4E-07 4 125
PF00025 Arf ADP-ribosylation factor family 1.8E-06 3 161
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.1E-05 4 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 1 311 2.0E-107
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 1 311 2.0E-107
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 1 311 2.0E-107
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 1 311 2.0E-107
sp|Q54IK1|RRAGA_DICDI Ras-related GTP-binding protein A OS=Dictyostelium discoideum GN=ragA PE=2 SV=1 1 308 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 1 311 2.0E-107
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 1 311 2.0E-107
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 1 311 2.0E-107
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 1 311 2.0E-107
sp|Q54IK1|RRAGA_DICDI Ras-related GTP-binding protein A OS=Dictyostelium discoideum GN=ragA PE=2 SV=1 1 308 2.0E-103
sp|Q5VZM2|RRAGB_HUMAN Ras-related GTP-binding protein B OS=Homo sapiens GN=RRAGB PE=1 SV=1 1 311 9.0E-101
sp|Q63487|RRAGB_RAT Ras-related GTP-binding protein B OS=Rattus norvegicus GN=RragB PE=1 SV=1 1 311 4.0E-100
sp|Q6NTA4|RRAGB_MOUSE Ras-related GTP-binding protein B OS=Mus musculus GN=Rragb PE=2 SV=1 1 311 4.0E-100
sp|O74824|GTR1_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr1 PE=3 SV=1 1 316 1.0E-99
sp|Q00582|GTR1_YEAST GTP-binding protein GTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR1 PE=1 SV=1 2 308 2.0E-85
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 3 244 1.0E-17
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 2 212 2.0E-16
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 2 212 2.0E-16
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 1 212 3.0E-14
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 1 212 5.0E-14
sp|P53290|GTR2_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR2 PE=1 SV=1 2 212 9.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055380
MKKKVLLMGASGSGKTSMRSLIFSNNPASLTSRLGATIDVEQNHVRFLGDLILNLWDCGGQDSFMDSYLTTQRST
IFQQVGVMIYVFDIESAEAEKDMEYYRDCLDGLRYYSPDAAIFLLLHKMDLVREPQQLLEKKRLELEEASGDVAI
SVFGTTIFDQTLYKAWSSIVHTLIPNAGILSKHLSIFAQACGATEVILFERTTFLVIATSSSGSGVASSAVPTYA
KDGSDHQLESTRYERTSELVKAFKYTCSRVREEFHTFEVDLPDFSAVLDELTRNTYVLVILHDPTIETAAVKLNI
RLARSKFETLQVDSLG*
Coding >AgabiH97|055380
ATGAAGAAAAAGGTCCTTCTCATGGGTGCCTCCGGCAGTGGGAAGACATCCATGAGATCACTGATCTTTTCGAAC
AATCCGGCCTCTCTCACGTCGCGCTTGGGTGCTACAATCGATGTGGAACAAAACCATGTTCGGTTTCTCGGTGAC
CTCATCCTCAACTTGTGGGACTGTGGTGGTCAAGACTCTTTCATGGACTCATATTTGACAACTCAACGGTCCACC
ATATTCCAACAAGTTGGCGTTATGATCTATGTCTTTGACATCGAGTCTGCCGAGGCCGAAAAAGATATGGAGTAT
TACCGTGACTGCCTCGACGGTCTACGCTACTACAGCCCAGATGCTGCCATTTTCCTCCTTCTACATAAAATGGAC
CTCGTCCGCGAACCGCAACAACTCCTCGAAAAAAAGCGGTTGGAATTGGAAGAAGCCAGCGGCGATGTCGCCATC
TCCGTGTTTGGAACAACCATTTTTGACCAGACCCTGTACAAGGCTTGGTCAAGTATCGTTCACACTCTCATCCCA
AATGCCGGCATTCTTTCGAAGCATCTGTCCATTTTCGCCCAAGCGTGTGGTGCAACCGAAGTCATTCTATTCGAA
CGCACAACTTTCCTCGTCATAGCTACTTCATCCTCTGGTTCTGGTGTAGCATCATCCGCCGTGCCGACATACGCT
AAGGACGGATCTGACCATCAACTCGAATCCACACGGTACGAACGTACTTCTGAACTTGTGAAGGCGTTCAAATAC
ACATGCTCCCGTGTCCGAGAAGAGTTCCATACCTTCGAAGTTGATCTGCCTGACTTTAGCGCTGTCTTGGATGAA
TTGACCAGGAACACTTACGTTCTCGTCATTCTTCATGACCCTACAATAGAAACGGCGGCCGTTAAACTCAATATC
CGTCTGGCACGAAGCAAATTCGAAACGCTTCAGGTGGATAGTCTCGGCTGA
Transcript >AgabiH97|055380
ATGAAGAAAAAGGTCCTTCTCATGGGTGCCTCCGGCAGTGGGAAGACATCCATGAGATCACTGATCTTTTCGAAC
AATCCGGCCTCTCTCACGTCGCGCTTGGGTGCTACAATCGATGTGGAACAAAACCATGTTCGGTTTCTCGGTGAC
CTCATCCTCAACTTGTGGGACTGTGGTGGTCAAGACTCTTTCATGGACTCATATTTGACAACTCAACGGTCCACC
ATATTCCAACAAGTTGGCGTTATGATCTATGTCTTTGACATCGAGTCTGCCGAGGCCGAAAAAGATATGGAGTAT
TACCGTGACTGCCTCGACGGTCTACGCTACTACAGCCCAGATGCTGCCATTTTCCTCCTTCTACATAAAATGGAC
CTCGTCCGCGAACCGCAACAACTCCTCGAAAAAAAGCGGTTGGAATTGGAAGAAGCCAGCGGCGATGTCGCCATC
TCCGTGTTTGGAACAACCATTTTTGACCAGACCCTGTACAAGGCTTGGTCAAGTATCGTTCACACTCTCATCCCA
AATGCCGGCATTCTTTCGAAGCATCTGTCCATTTTCGCCCAAGCGTGTGGTGCAACCGAAGTCATTCTATTCGAA
CGCACAACTTTCCTCGTCATAGCTACTTCATCCTCTGGTTCTGGTGTAGCATCATCCGCCGTGCCGACATACGCT
AAGGACGGATCTGACCATCAACTCGAATCCACACGGTACGAACGTACTTCTGAACTTGTGAAGGCGTTCAAATAC
ACATGCTCCCGTGTCCGAGAAGAGTTCCATACCTTCGAAGTTGATCTGCCTGACTTTAGCGCTGTCTTGGATGAA
TTGACCAGGAACACTTACGTTCTCGTCATTCTTCATGACCCTACAATAGAAACGGCGGCCGTTAAACTCAATATC
CGTCTGGCACGAAGCAAATTCGAAACGCTTCAGGTGGATAGTCTCGGCTGA
Gene >AgabiH97|055380
ATGAAGAAAAAGGTGAATGCGTCTGCCTCTCGACATCTGTCTCTGGCTGACTGTCACGTAGGTCCTTCTCATGGG
TGCCTCCGGCAGTGGGAAGACATCCATGAGATCACTGATCTTGTGAGCAAAAACCTCTCGTTTCTCCTCCTTGGC
TTGCCCATCTTGTTCACCAGTTCGAACAATCCGGCCTCTCTCACGTCGCGCTTGGGTGCTACAATCGATGTGGAA
CAAAACCATGTTCGGTTTCTCGGTGACCTCATCCTCAACTTGTGGGACTGTGGTGGTCAAGACTCTTTCATGGAC
TCATATTTGACAACTCAACGGTCCACCATATTCCAACAAGTTGGCGTTATGATCTATGTCTTTGACATCGAGTCT
GCCGAGGCCGAAAAAGATATGGAGTATTACCGTGACTGCCTCGACGGTCTACGCTACTACAGCCCAGATGCTGCC
ATTTTCCTCCTTCTACATAAAATGGACCTCGTCCGCGAACCGCAACAACTCCTCGAAAAAAAGCGGTTGGAATTG
GAAGAAGCCAGCGGCGATGTCGCCATCTCCGTGTTTGGAACAACCATTTTTGACCAGACCCTGTACAAGGTATGC
TCTCGCCCTCCTCTGACCCTTCATTCTTCTGACCTGGACCAATCGTACCAGGCTTGGTCAAGTATCGTTCACACT
CTCATCCCAAATGCCGGCATTCTTTCGAAGCATCTGTCCATTTTCGCCCAAGCGTGTGGTGCAACCGAAGTCATT
CTATTCGAACGCACAACTTTCCTCGTCATAGCTACTTCATCCTCTGGTTCTGGTGTAGCATCATCCGCCGTGCCG
ACATACGCTAAGGACGGATCTGACCATCAACTCGAATCCACACGGTACGAACGTACTTCTGAACTTGTGAAGGCG
TTCAAATACACATGCTCCCGTGTCCGAGAAGAGTTCCATACCTTCGAAGTTGATCTGCCTGACTTTAGCGCTGTC
TTGGATGAATTGACCAGGAACACTTACGTTCTCGTCATTCTTCATGACCCTACAATAGGTTGGTGCTTCCCAAGC
TGTTATTGATCTTATTGATCCATCCATCGCGCAGAAACGGCGGCCGTTAAACTCAATATCCGTCTGGCACGAAGC
AAATTCGAAACGCTTCAGGTGGATAGTCTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail