Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055350
Gene name
Locationscaffold_3:681655..683110
Strand-
Gene length (bp)1455
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.7E-12 85 170
PF12146 Hydrolase_4 Serine aminopeptidase, S33 8.5E-12 86 312
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.0E-08 103 300

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 103 316 1.0E-09
sp|B1ZB18|RUTD_METPB Putative aminoacrylate hydrolase RutD OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutD PE=3 SV=1 103 316 2.0E-09
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 103 316 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055350
MTSDKTKSRGTKGFSQFIGRWVYEPIQRYLSSGPSARHSSEAVHAEDATVKSSAAQVKYSTLMLADGAKLAYEIL
GSQHLGKMTPVVVVCGMAAIRGDNDTVINVLAKTYPVLVYDHRGMGDSSLSPKGDEEISIEMMARDLLFLLAKLG
WEEIILCGHSMGGTIAQQLLVLPYHPTAPAILHFKVTHLLLIATRCKVTEGGGLPIKSVPGKPRSLEERKEGAKR
VIAATLDPEWIKSNTERFNQLLGKAVNNNLCNRPAEVIAKQAVATRNFDFEKLLDRIPRTIQVLIIHGQLDQVIP
INHRDDIVKHIPWARLVEEGTLPGHVPTLQFGHLWYEYFDPQVWHDVVHTFVQRRET*
Coding >AgabiH97|055350
ATGACTTCCGACAAAACCAAATCTCGAGGCACCAAAGGCTTTTCTCAATTCATCGGCAGATGGGTGTACGAACCT
ATACAGAGATATCTTTCGTCAGGGCCTTCTGCACGACATTCCTCTGAAGCTGTACATGCTGAAGATGCTACTGTA
AAATCAAGTGCCGCCCAGGTTAAGTATTCAACCTTGATGCTTGCTGATGGTGCGAAACTCGCGTATGAGATATTG
GGATCTCAACATTTGGGCAAGATGACACCGGTCGTGGTGGTGTGCGGTATGGCTGCCATACGAGGCGACAATGAC
ACAGTGATCAACGTATTGGCGAAGACCTATCCAGTATTGGTGTATGATCATCGAGGAATGGGAGACTCGTCGCTG
AGTCCAAAAGGAGATGAAGAGATTTCGATCGAGATGATGGCGAGGGACCTCCTCTTCTTGCTGGCCAAACTTGGC
TGGGAAGAAATTATATTATGTGGTCATTCCATGGGTGGTACCATAGCTCAGCAATTACTAGTTCTCCCTTATCAC
CCAACAGCGCCAGCAATTCTACATTTCAAGGTCACGCACCTACTCTTAATAGCCACGCGTTGTAAAGTCACTGAG
GGTGGGGGACTGCCTATCAAATCTGTTCCTGGAAAACCACGCTCGCTAGAAGAAAGGAAAGAGGGCGCTAAACGA
GTTATAGCTGCTACTCTTGATCCAGAGTGGATTAAATCCAATACTGAACGCTTCAACCAGCTGCTAGGAAAGGCT
GTGAACAATAATTTGTGTAATCGACCGGCGGAGGTTATCGCTAAACAGGCTGTAGCGACACGGAATTTCGATTTT
GAAAAATTGCTTGACCGCATACCGAGAACGATTCAAGTTCTTATAATACATGGGCAATTGGATCAAGTCATTCCC
ATAAATCACAGAGATGATATTGTAAAACATATTCCTTGGGCAAGATTGGTTGAGGAAGGTACTTTACCTGGTCAT
GTCCCGACACTTCAATTCGGTCACCTCTGGTATGAATATTTCGATCCTCAAGTCTGGCATGATGTTGTGCATACG
TTTGTACAACGTCGAGAGACCTAG
Transcript >AgabiH97|055350
ATGACTTCCGACAAAACCAAATCTCGAGGCACCAAAGGCTTTTCTCAATTCATCGGCAGATGGGTGTACGAACCT
ATACAGAGATATCTTTCGTCAGGGCCTTCTGCACGACATTCCTCTGAAGCTGTACATGCTGAAGATGCTACTGTA
AAATCAAGTGCCGCCCAGGTTAAGTATTCAACCTTGATGCTTGCTGATGGTGCGAAACTCGCGTATGAGATATTG
GGATCTCAACATTTGGGCAAGATGACACCGGTCGTGGTGGTGTGCGGTATGGCTGCCATACGAGGCGACAATGAC
ACAGTGATCAACGTATTGGCGAAGACCTATCCAGTATTGGTGTATGATCATCGAGGAATGGGAGACTCGTCGCTG
AGTCCAAAAGGAGATGAAGAGATTTCGATCGAGATGATGGCGAGGGACCTCCTCTTCTTGCTGGCCAAACTTGGC
TGGGAAGAAATTATATTATGTGGTCATTCCATGGGTGGTACCATAGCTCAGCAATTACTAGTTCTCCCTTATCAC
CCAACAGCGCCAGCAATTCTACATTTCAAGGTCACGCACCTACTCTTAATAGCCACGCGTTGTAAAGTCACTGAG
GGTGGGGGACTGCCTATCAAATCTGTTCCTGGAAAACCACGCTCGCTAGAAGAAAGGAAAGAGGGCGCTAAACGA
GTTATAGCTGCTACTCTTGATCCAGAGTGGATTAAATCCAATACTGAACGCTTCAACCAGCTGCTAGGAAAGGCT
GTGAACAATAATTTGTGTAATCGACCGGCGGAGGTTATCGCTAAACAGGCTGTAGCGACACGGAATTTCGATTTT
GAAAAATTGCTTGACCGCATACCGAGAACGATTCAAGTTCTTATAATACATGGGCAATTGGATCAAGTCATTCCC
ATAAATCACAGAGATGATATTGTAAAACATATTCCTTGGGCAAGATTGGTTGAGGAAGGTACTTTACCTGGTCAT
GTCCCGACACTTCAATTCGGTCACCTCTGGTATGAATATTTCGATCCTCAAGTCTGGCATGATGTTGTGCATACG
TTTGTACAACGTCGAGAGACCTAG
Gene >AgabiH97|055350
ATGACTTCCGACAAAACCAAATCTCGAGGCACCAAAGGCTTTTCTCAATTCATCGGCAGATGGGTGTACGAACCT
ATACAGAGATATCTTTCGTCAGGGCCTTCTGCACGACATTCCTCTGAAGCTGTACATGCTGAAGATGCTACTGTA
AAATCAAGTGCCGCCCAGGTTAAGTATTCAACCTTGATGCTTGCTGATGGTGCGAAACTCGCGTATGAGATATTG
GGATCTCAACATTTGGGCAAGATGACACCGGTCGTGGTGGTGTGCGGTATGGCTGCCATACGAGGCGACAATGAC
ACAGTGATCAACGTATTGGCGAAGACCTATCCAGGTATATTCGAAATTATAATGTTAAGAATTGTGGCTAATTAC
TTTTCCAGTATTGGTGTATGATCATCGGTGAGCTTGCACTCGTTGGTAGACTCGATATATCATTGATTACCGACC
GGCAGAGGAATGGGAGACTCGTCGCTGAGTCCAAAAGGAGATGAAGAGATTTCGATCGAGATGATGGCGAGGGAC
CTCCTCTTCTTGCTGGCCAAACTTGGCTGGGAAGAAATTATATTATGTGGTCATTCCATGGGTGGTAAGGAAATA
CTCAATTGCTATTCGAACATTGAGTTAAAACTTTCACTAGGTACCATAGCTCAGCAATTACTAGTTCTCCCTTAT
CACCCAACAGCGCCAGCAATTCTACATTTCAAGGTCACGCACCTACTCTTAATAGCCACGCGTTGTAAAGTCACT
GAGGGTGGGGGACTGCCTATCAAATCTGTTCCTGGAAAACCACGCTCGCTAGAAGAAAGGAAAGAGGGCGCTAAA
CGAGTTATAGCTGCTACTCTTGATCCAGAGTGGATTAAATCCAATACTGAACGCTTCAACCAGCTGCTAGGAAAG
GCTGTGAACAATAATTTGTGGTTTGTATACATATTTCACTGATCTGATGGTTTTGCTGACTTTACCCTCTTGGAT
AGTAATCGACCGGCGGAGGTTATCGGTGAGGACACTTCTTTTGTACTACTTTGGGTTCTAGCTGAAACGGTGGAT
AGCTAAACAGGCTGTAGCGGTATGTTCTCCAGCATTCCTTTTCGCCTTCTATTTCCTCATTTTCTATGGAATCTA
GACACGGAATTTCGATTTTGAAAAATTGCTTGACCGCATACCGAGAACGATTCAAGTTCTTATAATACATGGGCA
ATTGGATCAAGTCATTCCCATAAATCACAGAGATGTAAGTTTTTATCGTTTGAGCTGTGGTGAAAATTGTTGATG
ATAGTTGGCGCGGCATCTCAGGATATTGTAAAACATATTCCTTGGGCAAGATTGGTTGAGGAAGGTACTTTACCT
GGTCATGTCCCGACACTTCAATTCGGTCACCTCTGGTATGAATATTTCGATCCTCAAGTCTGGCATGATGTTGTG
CATACGTTTGTACAACGTCGAGAGACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail