Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055160
Gene name
Locationscaffold_3:632569..634196
Strand+
Gene length (bp)1627
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 2.5E-11 157 211
PF00013 KH_1 KH domain 1.3E-13 232 295
PF00013 KH_1 KH domain 2.3E-15 353 427
PF07650 KH_2 KH domain 1.3E-05 233 266

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 148 437 1.0E-45
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 97 433 2.0E-45
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 145 449 2.0E-45
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 145 433 4.0E-45
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 145 434 6.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 148 437 1.0E-45
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 97 433 2.0E-45
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 145 449 2.0E-45
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 145 433 4.0E-45
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 145 434 6.0E-45
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 145 449 6.0E-45
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 146 433 1.0E-39
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 145 433 6.0E-38
sp|P38151|PBP2_YEAST PAB1-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBP2 PE=1 SV=1 146 442 4.0E-35
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 145 362 3.0E-28
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 145 362 3.0E-28
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 145 362 3.0E-28
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 145 362 3.0E-28
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 134 436 4.0E-22
sp|P38199|HEK2_YEAST Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEK2 PE=1 SV=1 120 446 2.0E-20
sp|A6ZKR5|HEK2_YEAS7 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=HEK2 PE=3 SV=1 120 446 2.0E-20
sp|C5DIR2|HEK2_LACTC Heterogeneous nuclear rnp K-like protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=HEK2 PE=3 SV=1 148 437 2.0E-20
sp|C8Z3W4|HEK2_YEAS8 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HEK2 PE=3 SV=1 120 446 2.0E-20
sp|C7GND0|HEK2_YEAS2 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=HEK2 PE=3 SV=1 120 446 2.0E-20
sp|B3LNH0|HEK2_YEAS1 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HEK2 PE=3 SV=1 120 437 3.0E-20
sp|Q6CNI6|HEK2_KLULA Heterogeneous nuclear rnp K-like protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEK2 PE=3 SV=1 130 437 4.0E-19
sp|C5E0I9|HEK2_ZYGRC Heterogeneous nuclear rnp K-like protein 2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HEK2 PE=3 SV=1 148 437 9.0E-18
sp|Q756R8|HEK2_ASHGO Heterogeneous nuclear rnp K-like protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEK2 PE=3 SV=1 157 441 2.0E-17
sp|Q6FUD8|HEK2_CANGA Heterogeneous nuclear rnp K-like protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEK2 PE=3 SV=1 151 389 1.0E-15
sp|A7TT46|HEK2_VANPO Heterogeneous nuclear rnp K-like protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=HEK2 PE=3 SV=1 151 446 4.0E-15
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 150 426 5.0E-15
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 233 435 2.0E-14
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 233 435 4.0E-14
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 233 435 8.0E-14
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 149 283 4.0E-13
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 149 283 5.0E-13
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 150 433 6.0E-13
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 99 433 2.0E-12
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 149 304 3.0E-12
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 147 430 3.0E-12
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 149 283 1.0E-11
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 146 387 1.0E-11
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 147 430 1.0E-11
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 153 430 2.0E-11
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 147 430 3.0E-11
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 353 434 1.0E-10
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 353 434 1.0E-10
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 353 434 1.0E-10
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 353 434 1.0E-10
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 161 431 1.0E-10
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 161 431 2.0E-10
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 161 431 2.0E-10
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 161 431 2.0E-10
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 146 433 3.0E-10
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 112 314 3.0E-10
sp|O42254|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus GN=IGF2BP1 PE=1 SV=1 146 433 4.0E-10
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 150 433 7.0E-10
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 146 433 7.0E-10
sp|Q3T0D0|HNRPK_BOVIN Heterogeneous nuclear ribonucleoprotein K OS=Bos taurus GN=HNRNPK PE=2 SV=1 294 432 1.0E-09
sp|Q5R5H8|HNRPK_PONAB Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii GN=HNRNPK PE=2 SV=1 294 432 1.0E-09
sp|Q4R4M6|HNRPK_MACFA Heterogeneous nuclear ribonucleoprotein K OS=Macaca fascicularis GN=HNRNPK PE=2 SV=1 294 432 1.0E-09
sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 294 432 1.0E-09
sp|P61980|HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus GN=Hnrnpk PE=1 SV=1 294 432 1.0E-09
sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus GN=Hnrnpk PE=1 SV=1 294 432 1.0E-09
sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 294 432 1.0E-09
sp|O88477|IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus GN=Igf2bp1 PE=1 SV=1 146 433 1.0E-09
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 146 433 2.0E-09
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 150 433 4.0E-09
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 153 431 1.0E-08
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 150 279 1.0E-08
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 152 279 1.0E-08
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 150 279 2.0E-08
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 152 431 2.0E-08
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 327 432 2.0E-08
sp|Q3T0D0|HNRPK_BOVIN Heterogeneous nuclear ribonucleoprotein K OS=Bos taurus GN=HNRNPK PE=2 SV=1 148 314 2.0E-08
sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 148 314 2.0E-08
sp|O57526|IF23B_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-B OS=Xenopus laevis GN=igf2bp3-b PE=1 SV=1 139 433 2.0E-08
sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 146 433 2.0E-08
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 152 431 3.0E-08
sp|Q5R5H8|HNRPK_PONAB Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii GN=HNRNPK PE=2 SV=1 148 314 3.0E-08
sp|Q4R4M6|HNRPK_MACFA Heterogeneous nuclear ribonucleoprotein K OS=Macaca fascicularis GN=HNRNPK PE=2 SV=1 148 314 3.0E-08
sp|P61980|HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus GN=Hnrnpk PE=1 SV=1 148 314 3.0E-08
sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus GN=Hnrnpk PE=1 SV=1 148 314 3.0E-08
sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 148 314 3.0E-08
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 147 320 3.0E-08
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 161 430 5.0E-08
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 161 264 5.0E-08
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 161 264 6.0E-08
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 162 304 7.0E-08
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 147 320 7.0E-08
sp|O42254|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus GN=IGF2BP1 PE=1 SV=1 130 305 8.0E-08
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 226 435 1.0E-07
sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1 162 426 1.0E-07
sp|O57526|IF23B_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-B OS=Xenopus laevis GN=igf2bp3-b PE=1 SV=1 137 322 2.0E-07
sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 162 304 2.0E-07
sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 146 433 2.0E-07
sp|O73932|IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis GN=igf2bp3-a PE=1 SV=1 143 322 5.0E-07
sp|Q5ZLP8|IF2B3_CHICK Insulin-like growth factor 2 mRNA-binding protein 3 OS=Gallus gallus GN=IGF2BP3 PE=2 SV=1 143 299 5.0E-07
sp|O73932|IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis GN=igf2bp3-a PE=1 SV=1 139 433 7.0E-07
sp|O88477|IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus GN=Igf2bp1 PE=1 SV=1 150 305 1.0E-06
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 150 305 2.0E-06
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 153 431 2.0E-06
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 150 305 2.0E-06
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 150 305 2.0E-06
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 228 449 3.0E-06
sp|Q9SZH4|PEP_ARATH RNA-binding KH domain-containing protein PEPPER OS=Arabidopsis thaliana GN=PEP PE=2 SV=1 98 288 3.0E-06
sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 117 299 4.0E-06
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 230 449 5.0E-06
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 228 449 5.0E-06
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 231 295 6.0E-06
sp|Q3T0D0|HNRPK_BOVIN Heterogeneous nuclear ribonucleoprotein K OS=Bos taurus GN=HNRNPK PE=2 SV=1 231 295 6.0E-06
sp|Q5R5H8|HNRPK_PONAB Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii GN=HNRNPK PE=2 SV=1 231 295 6.0E-06
sp|Q4R4M6|HNRPK_MACFA Heterogeneous nuclear ribonucleoprotein K OS=Macaca fascicularis GN=HNRNPK PE=2 SV=1 231 295 6.0E-06
sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 231 295 6.0E-06
sp|P61980|HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus GN=Hnrnpk PE=1 SV=1 231 295 6.0E-06
sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus GN=Hnrnpk PE=1 SV=1 231 295 6.0E-06
sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 231 295 6.0E-06
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 342 426 8.0E-06
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 342 426 9.0E-06
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 342 426 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055160
MLCCEPRDLPALFSPPGAVAQNSSHPQTSIPSHIRSQIPTPNPNPRPRSRSPSDGDQKQYKRANTGAAPSDAAPA
HSSSSVERNMTSDPTAKHFSGGDDNAGSTPGSNPSDKQKDDSIKSNPDSGDKAGSSYGEASTTASAVPPSANIHM
RCLIVTQDASIIIGKGGSHVNEIREKSGARVMVSESIPGNPERILNVSGPLDAVSKAFGLIVRRINDEPFDVPSV
PGSRAVTIKFMIPNSRMGSVIGKGGSKIKEIQDASGAKLNASEGMLPGSTERVLSVAGVADAIHIATYYIGTILI
EAQERMPSTSNSTYRPSSQPRRPTQGGGSSYVPGYSHHAPYGPPHNPPQQLQTQQIYIPNDLVGCIIGKGGSKIN
EIRHMSASQIKIMEPGATGLGPNGAPGGSEGERLVVITGQPANIQMAVQLLYHRLEQEKQKQLRAQQGGSSGSS*
Coding >AgabiH97|055160
ATGTTGTGTTGTGAGCCGCGCGACCTGCCAGCTTTGTTCTCTCCGCCAGGCGCAGTTGCCCAGAACTCTTCACAT
CCACAAACCTCAATCCCATCCCATATCCGGTCCCAAATCCCAACCCCAAATCCCAATCCTAGACCTAGGTCTCGT
TCTCCCTCCGACGGCGACCAAAAACAATACAAGCGCGCCAACACGGGCGCGGCGCCTTCGGATGCCGCTCCAGCA
CACAGCTCGAGCTCTGTCGAACGCAACATGACATCTGACCCTACTGCAAAACACTTCTCCGGAGGCGACGACAAT
GCGGGCTCCACTCCGGGATCAAATCCTTCTGACAAGCAAAAGGATGACAGCATTAAATCCAATCCCGACTCTGGT
GACAAGGCCGGATCCTCTTATGGTGAAGCCTCAACGACTGCATCTGCTGTTCCTCCTTCCGCCAACATCCACATG
CGCTGTCTCATTGTCACCCAGGACGCGTCTATCATCATTGGCAAGGGAGGTTCCCATGTCAATGAGATTCGGGAA
AAGAGCGGTGCGCGGGTGATGGTTTCTGAGAGTATCCCCGGGAACCCAGAACGCATTCTGAATGTCAGCGGGCCG
TTAGACGCAGTATCCAAAGCGTTCGGTCTCATTGTGCGCAGGATCAATGACGAGCCTTTTGACGTGCCCTCTGTG
CCCGGTAGCCGTGCTGTAACCATCAAGTTTATGATTCCTAATTCCCGCATGGGCTCTGTCATTGGCAAAGGAGGT
TCCAAGATCAAGGAGATTCAGGATGCCAGTGGTGCAAAGCTAAATGCAAGCGAAGGAATGTTACCGGGCTCGACA
GAGCGCGTTCTCAGCGTTGCAGGGGTCGCGGACGCCATTCACATTGCCACGTACTATATCGGCACTATTTTGATT
GAGGCGCAGGAGCGTATGCCGTCAACTTCAAACTCCACTTATCGTCCGTCTAGTCAACCACGTCGACCTACTCAG
GGGGGCGGCTCTTCTTATGTTCCCGGTTATTCTCATCATGCTCCTTATGGACCTCCTCACAATCCACCTCAACAG
CTTCAAACACAACAGATCTATATTCCAAATGACTTAGTTGGATGTATCATTGGAAAAGGGGGCAGCAAGATTAAT
GAAATCAGACATATGAGTGCCAGCCAGATCAAAATTATGGAGCCGGGTGCAACTGGCCTTGGACCTAATGGGGCG
CCGGGAGGGAGTGAAGGGGAACGCTTAGTGGTCATCACGGGACAGCCTGCCAATATACAGATGGCGGTGCAACTT
TTGTACCATCGGTTGGAACAGGAGAAGCAGAAGCAGCTTCGCGCTCAACAAGGAGGATCGTCGGGTTCAAGTTGA
Transcript >AgabiH97|055160
ATGTTGTGTTGTGAGCCGCGCGACCTGCCAGCTTTGTTCTCTCCGCCAGGCGCAGTTGCCCAGAACTCTTCACAT
CCACAAACCTCAATCCCATCCCATATCCGGTCCCAAATCCCAACCCCAAATCCCAATCCTAGACCTAGGTCTCGT
TCTCCCTCCGACGGCGACCAAAAACAATACAAGCGCGCCAACACGGGCGCGGCGCCTTCGGATGCCGCTCCAGCA
CACAGCTCGAGCTCTGTCGAACGCAACATGACATCTGACCCTACTGCAAAACACTTCTCCGGAGGCGACGACAAT
GCGGGCTCCACTCCGGGATCAAATCCTTCTGACAAGCAAAAGGATGACAGCATTAAATCCAATCCCGACTCTGGT
GACAAGGCCGGATCCTCTTATGGTGAAGCCTCAACGACTGCATCTGCTGTTCCTCCTTCCGCCAACATCCACATG
CGCTGTCTCATTGTCACCCAGGACGCGTCTATCATCATTGGCAAGGGAGGTTCCCATGTCAATGAGATTCGGGAA
AAGAGCGGTGCGCGGGTGATGGTTTCTGAGAGTATCCCCGGGAACCCAGAACGCATTCTGAATGTCAGCGGGCCG
TTAGACGCAGTATCCAAAGCGTTCGGTCTCATTGTGCGCAGGATCAATGACGAGCCTTTTGACGTGCCCTCTGTG
CCCGGTAGCCGTGCTGTAACCATCAAGTTTATGATTCCTAATTCCCGCATGGGCTCTGTCATTGGCAAAGGAGGT
TCCAAGATCAAGGAGATTCAGGATGCCAGTGGTGCAAAGCTAAATGCAAGCGAAGGAATGTTACCGGGCTCGACA
GAGCGCGTTCTCAGCGTTGCAGGGGTCGCGGACGCCATTCACATTGCCACGTACTATATCGGCACTATTTTGATT
GAGGCGCAGGAGCGTATGCCGTCAACTTCAAACTCCACTTATCGTCCGTCTAGTCAACCACGTCGACCTACTCAG
GGGGGCGGCTCTTCTTATGTTCCCGGTTATTCTCATCATGCTCCTTATGGACCTCCTCACAATCCACCTCAACAG
CTTCAAACACAACAGATCTATATTCCAAATGACTTAGTTGGATGTATCATTGGAAAAGGGGGCAGCAAGATTAAT
GAAATCAGACATATGAGTGCCAGCCAGATCAAAATTATGGAGCCGGGTGCAACTGGCCTTGGACCTAATGGGGCG
CCGGGAGGGAGTGAAGGGGAACGCTTAGTGGTCATCACGGGACAGCCTGCCAATATACAGATGGCGGTGCAACTT
TTGTACCATCGGTTGGAACAGGAGAAGCAGAAGCAGCTTCGCGCTCAACAAGGAGGATCGTCGGGTTCAAGTTGA
Gene >AgabiH97|055160
ATGTTGTGTTGTGAGCCGCGCGACCTGCCAGCTTTGTTCTCTCCGCCAGGCGCAGTTGCCCAGGTACGTCTCTTT
GCCGTCGTGTGCCCCTCCCGCCATCCTCGCATCCCCCTCACACCCCCCGCCATGTCCATCAGAACTCTTCACATC
CACAAACCTCAATCCCATCCCATATCCGGTCCCAAATCCCAACCCCAAATCCCAATCCTAGACCTGTTCCTAAAA
CTCTGAGTGTAAACTGATGCCAGACGCTGACTCCACCCGCAAGAGGTCTCGTTCTCCCTCCGACGGCGACCAAAA
ACAATACAAGCGCGCCAACACGGGCGCGGCGCCTTCGGATGCCGCTCCAGCACACAGCTCGAGCTCTGTCGAACG
CAACATGACATCTGACCCTACTGCAAAACACTTCTCCGGAGGCGACGACAATGCGGGCTCCACTCCGGGATCAAA
TCCTTCTGACAAGCAAAAGGATGACAGCATTAAATCCAATCCCGACTCTGGTGACAAGGCCGGATCCTCTTATGG
TGAAGCCTCAACGACTGCATCTGCTGTTCCTCCTTCCGCCAACATCCACATGCGCTGTCTCATTGTCACCCAGGA
CGCGTCTATCATCATTGGCAAGGGAGGTTCCCATGTCAATGAGATTCGGGAAAAGAGCGGTGCGCGGGTGATGGT
TTCTGAGAGTATCCCCGGGAACCCAGAACGCATTCTGAATGTCAGCGGGCCGTTAGACGCAGTATCCAAAGTGGG
TAATTTGAAAGTGTGTTACCCGCGATGCTTATCATCCGTTAGGCGTTCGGTCTCATTGTGCGCAGGATCAATGAC
GAGCCTTTTGACGTGCCCTCTGTGCCCGGTAGCCGTGCTGTAACCATCAAGTTTATGATTCCTAATTCCCGCATG
GGCTCTGTCATTGGCAAAGGAGGTTCCAAGATCAAGGAGATTCAGGATGCCAGTGGTGCAAAGCTAAATGCAAGC
GAAGGAATGTTACCGGGCTCGACAGAGGTAAACATCATCCTTTGGCAAGTTTATCTCCTTGCTGATATTATTGGT
AGCGCGTTCTCAGCGTTGCAGGGGTCGCGGACGCCATTCACATTGCCACGTACTATATCGGCACTATTTTGATTG
AGGCGCAGGAGCGTATGCCGTCAACTTCAAACTCCACTTATCGTCCGTCTAGTCAACCACGTCGACCTACTCAGG
GGGGCGGCTCTTCTTATGTTCCCGGTTATTCTCATCATGCTCCTTATGGACCTCCTCACAATCCACCTCAACAGC
TTCAAACACAACAGATCTATATTCCAAATGACTTAGTTGGATGTATCATTGGAAAAGGGGGCAGCAAGATTAATG
AAATCAGACATATGAGTGCCAGCCAGATCAAAATTATGGAGCCGGGTGCAACTGGCCTTGGACCTAATGGGGCGC
CGGGAGGGAGTGAAGGGGAACGCTTAGTGGTCATCACGGGACAGCCTGCCAATATACAGATGGCGGTGCAACTTT
TGTACCATGTAGGTAACAGTCAGCCCACATGTCATTACTTGCTCTTACGAATGACTTATAGCGGTTGGAACAGGA
GAAGCAGAAGCAGCTTCGCGCTCAACAAGGAGGATCGTCGGGTTCAAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail