Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055140
Gene name
Locationscaffold_3:626330..629242
Strand-
Gene length (bp)2912
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12891 Glyco_hydro_44 Glycoside hydrolase family 44 4.6E-67 319 534

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22533|MANB_CALSA Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus GN=manA PE=1 SV=2 275 714 4.0E-38
sp|P29719|GUNA_PAELA Endoglucanase A OS=Paenibacillus lautus GN=celA PE=3 SV=1 272 707 7.0E-38

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055140
MHIGSCFVKLLAFVLAAAISKVAADDLSIYTDNNVNNGWENWSWSSTIDFAATDLIAGSSGSSISVTSEQFAALS
LHYNAAPIKGFEGLQFDIAGDQPDISISIESVADGVISPSMALSSISKSITSDSFTTVLINFNDLPGNGGTLADQ
NWDRISFQAGNNGATYHVDNMLFVESIVIAPEFLSAEPLGSNVVAVTTKGDVDFSTVRVKLNGNTVRITGKTSYS
PVDTPAQSITYLTLASSLRPGKLVITADGGKSFDYTLSNALSGSINKSIKSPINPHIYGVNFPVSADYIQHLGIT
ISRWGGNAVTAYNPFDGFTNAGADWYFENRGSTDGTAEDWLAWVQGAGSDALLTVPALDWVSKDSTSYSYPVSIY
GDQADTDPFNSDAGNGLFPNGTAVAPPDPTTVYTGWNTSLAQTWLKGLANKPLMVAIDNEIEIASSTHRDMHPDP
MSYDEELDRVVRFATTAKEAIPDILVVAPSTCCWWFYWTTTVGWDDTTAHNNTDFLPWFLGQMKAVEATTGKRLL
DYLDIHYYFAADTSANDDAAKAKRLRMTRSWWDESYVDESWVGQDPIQNHQPEADRVELIPRFKSLIDSIYPGTK
LSISEWNSQADNDITGGLVTAESLGIFGRYGIDAATYWATPGEKAPAGLAYWLYRGYGTYFGDQTAQVKLYNPDP
DTWSIFAGSDNNKLTLVIINKKPDQALSFNLSNVPTGSYFMRHFGGAAGVAKWQTTITLTTNKFIVVPSYTAVFL
KQQ*
Coding >AgabiH97|055140
ATGCATATCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCCATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATAATGGATGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCTGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATTGCCGGAGACCAACCTGATATT
TCCATCTCGATCGAATCTGTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCAAGTCTATC
ACCTCCGACAGCTTTACCACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGCCGACCAA
AATTGGGACCGTATCAGTTTCCAAGCTGGTAACAATGGTGCAACATATCATGTGGACAATATGCTTTTTGTTGAA
AGCATTGTTATCGCACCCGAATTTCTGAGTGCCGAACCTCTCGGAAGTAATGTGGTCGCAGTTACCACCAAAGGC
GATGTCGACTTTTCCACTGTGCGGGTGAAATTGAATGGCAACACTGTCAGAATCACTGGAAAGACGTCATATTCA
CCAGTCGACACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATC
ACTGCCGACGGTGGCAAATCTTTCGACTACACTCTGTCCAACGCCCTATCTGGCAGCATTAACAAGAGCATCAAG
TCGCCCATCAATCCTCATATTTATGGTGTCAACTTCCCCGTTAGTGCTGATTATATTCAGCATCTTGGTATCACA
ATTTCGCGTTGGGGTGGTAACGCTGTTACTGCTTATAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGG
TACTTTGAGAATAGAGGCTCTACCGATGGTACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGAT
GCGCTCTTGACAGTACCTGCTCTAGATTGGGTCTCTAAAGACAGTACATCGTACTCATATCCAGTATCTATCTAT
GGAGACCAGGCGGACACCGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCCAACGGTACCGCAGTAGCT
CCACCCGATCCTACCACTGTTTATACAGGCTGGAACACTAGCCTTGCCCAAACGTGGCTCAAAGGCCTTGCCAAT
AAACCCCTTATGGTCGCAATCGATAACGAAATCGAAATCGCAAGTAGCACTCACCGGGATATGCATCCCGATCCA
ATGAGCTACGACGAAGAATTAGACCGCGTTGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTG
GTTGTCGCGCCTTCTACCTGCTGTTGGTGGTTCTACTGGACCACCACTGTCGGTTGGGATGATACGACGGCACAT
AATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGAAGGCGGTCGAGGCGACCACTGGAAAGCGACTTCTT
GATTATCTCGACATTCATTATTACTTCGCGGCTGATACCAGTGCAAATGACGATGCTGCTAAAGCTAAGAGGTTG
AGAATGACCCGTAGCTGGTGGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAAGACCCTATCCAGAACCAT
CAACCCGAAGCTGACCGTGTTGAACTCATCCCTCGTTTCAAGTCATTAATAGATTCTATCTATCCTGGAACCAAA
CTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTAACAGCGGAGTCTCTCGGT
ATCTTTGGTCGATATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAAGCTCCTGCTGGTTTGGCT
TACTGGCTTTATCGAGGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCT
GATACTTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAG
GCTCTTTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGTGCTGCCGGCGTT
GCTAAGTGGCAGACTACGATTACTTTGACCACAAACAAGTTTATTGTTGTCCCTAGCTATACTGCTGTCTTCTTG
AAGCAACAGTAG
Transcript >AgabiH97|055140
ATGCATATCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCCATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATAATGGATGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCTGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATTGCCGGAGACCAACCTGATATT
TCCATCTCGATCGAATCTGTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCAAGTCTATC
ACCTCCGACAGCTTTACCACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGCCGACCAA
AATTGGGACCGTATCAGTTTCCAAGCTGGTAACAATGGTGCAACATATCATGTGGACAATATGCTTTTTGTTGAA
AGCATTGTTATCGCACCCGAATTTCTGAGTGCCGAACCTCTCGGAAGTAATGTGGTCGCAGTTACCACCAAAGGC
GATGTCGACTTTTCCACTGTGCGGGTGAAATTGAATGGCAACACTGTCAGAATCACTGGAAAGACGTCATATTCA
CCAGTCGACACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATC
ACTGCCGACGGTGGCAAATCTTTCGACTACACTCTGTCCAACGCCCTATCTGGCAGCATTAACAAGAGCATCAAG
TCGCCCATCAATCCTCATATTTATGGTGTCAACTTCCCCGTTAGTGCTGATTATATTCAGCATCTTGGTATCACA
ATTTCGCGTTGGGGTGGTAACGCTGTTACTGCTTATAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGG
TACTTTGAGAATAGAGGCTCTACCGATGGTACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGAT
GCGCTCTTGACAGTACCTGCTCTAGATTGGGTCTCTAAAGACAGTACATCGTACTCATATCCAGTATCTATCTAT
GGAGACCAGGCGGACACCGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCCAACGGTACCGCAGTAGCT
CCACCCGATCCTACCACTGTTTATACAGGCTGGAACACTAGCCTTGCCCAAACGTGGCTCAAAGGCCTTGCCAAT
AAACCCCTTATGGTCGCAATCGATAACGAAATCGAAATCGCAAGTAGCACTCACCGGGATATGCATCCCGATCCA
ATGAGCTACGACGAAGAATTAGACCGCGTTGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTG
GTTGTCGCGCCTTCTACCTGCTGTTGGTGGTTCTACTGGACCACCACTGTCGGTTGGGATGATACGACGGCACAT
AATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGAAGGCGGTCGAGGCGACCACTGGAAAGCGACTTCTT
GATTATCTCGACATTCATTATTACTTCGCGGCTGATACCAGTGCAAATGACGATGCTGCTAAAGCTAAGAGGTTG
AGAATGACCCGTAGCTGGTGGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAAGACCCTATCCAGAACCAT
CAACCCGAAGCTGACCGTGTTGAACTCATCCCTCGTTTCAAGTCATTAATAGATTCTATCTATCCTGGAACCAAA
CTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTAACAGCGGAGTCTCTCGGT
ATCTTTGGTCGATATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAAGCTCCTGCTGGTTTGGCT
TACTGGCTTTATCGAGGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCT
GATACTTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAG
GCTCTTTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGTGCTGCCGGCGTT
GCTAAGTGGCAGACTACGATTACTTTGACCACAAACAAGTTTATTGTTGTCCCTAGCTATACTGCTGTCTTCTTG
AAGCAACAGTAG
Gene >AgabiH97|055140
ATGCATATCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCCATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATAATGGATGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCTGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATTGCCGTAAGTTTTGAAGTGTGT
TTTGAAGTACGATTATTGCTGAACTTTTGTGTTACTCAGGGAGACCAACCTGATATTTCCATCTCGATCGAATCT
GTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCAAGTCTATCACCTCCGACAGCTTTACC
ACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGTGAGCCAAGATGCCTTTAGCTTGGAG
AACACTAGCTAATTTCATATGGAAATAAGGCCGACCAAAATTGGGACCGTATCAGTTTCCAAGCTGGTAACAATG
GTGCAACAGTTAGTTTCTGCAACAATACTACTGGAATAAAAGTACTAACCAGTCAATTCGCCAGTATCATGTGGA
CAATATGCTTTTTGTTGAAAGCATTGTTATCGCACCCGAATTTCTGAGTGCCGAACCTCTCGGAAGTAATGTGGT
CGCAGTTACCACCAAAGGCGATGTCGACTTTTCCACTGTGCGGGTGAAATTGAATGGCAACGTAAGCTATTCAGT
TGGCATTTTAATGCTTGCTTTACCCATTTGCAATGCAAGACTGTCAGAATCACTGGAAAGACGTCATATTCACCA
GTCGACACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATCACT
GCCGACGGTGGCAAATCTTTCGACTACACTCTGTCCAACGCCCTATCTGGCAGGTGTGTTCCCGTCCACCTGCTT
ACGAGCAACACTGATGGGGAACATTTAGCATTAACAAGAGCATCAAGTCGCCCATCAATCCTCATATTTATGGTG
TCAACTTCCCCGTTAGTGCTGATTATATTCAGCATCTTGGTATCACAATTTCGCGTTGGGGTGGTAACGCTGTTA
CTGCTTATAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGGTACTTTGAGAATAGAGGCTCTACCGATG
GTACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGATGCGCTCTTGACAGTACCTGCGTATGTAT
TGATTTCGGACCCGCCGATTTCAGTTTTCGATTAATTCTTCTTAAAGTCTAGATTGGGTCTCTAAAGACAGTACA
TCGTACTCATATCCAGTATCTATCTATGGAGGTAACCCATATACGCCTTGTCTCTCTTGCACTCAAACTAATGTC
CCATAGACCAGGCGGACACCGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCCAACGGTACCGCAGTAG
CTCCACCCGATCCTACCACTGTTTATACAGGCTGGAACACTAGCCTTGCCCAAACGTGGCTCAAAGGCCTTGCCA
ATAAACCCCTTATGGTCGCAATCGATAACGAAATCGAAATCGCAAGTAGCACTCACCGGGATATGCATCCCGAGT
ACGTTATTCCAATTTCGTTGATATTTTTCGGTTTGTTCTTATGATCCATTAGTCCAATGAGCTACGACGAAGAAT
TAGACCGCGTTGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTGGTTGTCGCGCCTTCTACCT
GCTGTTGGTGGTTCTGTGAGTAGGGCATCTATTCCTATATCAGATTGATTGAATTGTCCTGCGCAGACTGGACCA
CCACTGTCGGTTGGGATGATACGACGGCACATAATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGAAGG
CGGTCGAGGCGACCACTGGAAAGCGACTTCTTGATTATCTCGACATTCATTATTACTTCGCGGCTGATACCAGTG
CAAATGACGATGCTGCTAAAGCTAAGAGGTTGAGAATGACCCGTAGCTGGTGGGTAAGTCGAACGTAACTCCCCG
TGTGGTCGAAAGATGTAATATTCATAAATTATTTAGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAAGAC
CCTATCCAGAACCATCAACCCGAAGCTGACCGTGTTGAACTCATCCCTCGTTTCAAGTCATTAATAGATTCTATC
TATCCTGGAACCAAACTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTAACA
GCGGAGTCTCTCGGTATCTTTGGTCGATATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAAGCT
CCTGCTGGTTTGGCTTACTGGCTTTATCGAGGGTATGATATTCGATCTTTTGGTTCAATGCTATTCTAAGCGATT
TCCGGCCGTCAGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCTGATAC
TTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAGGCTCT
TTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGTGCTGCCGGCGTTGCTAA
GTGGCAGGTATGTGATGTGTGGCTCGTATATTTTGTATCCTCTGCTGACCTTTGATTTGTAGACTACGATTACTT
TGACCACAAACAAGTTTATTGTTGTCCCTAGCTATACTGCTGTCTTCTTGAAGCAACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail