Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|055130
Gene name
Locationscaffold_3:623464..625461
Strand-
Gene length (bp)1997
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 4.6E-84 10 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPG0|GPI10_ASPFU GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi10 PE=3 SV=1 4 571 8.0E-78
sp|Q2UH15|GPI10_ASPOR GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi10 PE=3 SV=1 17 571 6.0E-69
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 13 575 2.0E-66
sp|Q6BH65|GPI10_DEBHA GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI10 PE=3 SV=2 10 571 3.0E-65
sp|Q6CAB8|GPI10_YARLI GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI10 PE=3 SV=1 13 572 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPG0|GPI10_ASPFU GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi10 PE=3 SV=1 4 571 8.0E-78
sp|Q2UH15|GPI10_ASPOR GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi10 PE=3 SV=1 17 571 6.0E-69
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 13 575 2.0E-66
sp|Q6BH65|GPI10_DEBHA GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI10 PE=3 SV=2 10 571 3.0E-65
sp|Q6CAB8|GPI10_YARLI GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI10 PE=3 SV=1 13 572 1.0E-63
sp|Q5BCB9|GPI10_EMENI GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi10 PE=3 SV=1 13 571 1.0E-59
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 2 494 4.0E-58
sp|Q4IB63|GPI10_GIBZE GPI mannosyltransferase 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI10 PE=3 SV=1 10 482 6.0E-57
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 4 494 6.0E-57
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 2 484 2.0E-55
sp|Q9VZM5|PIGB_DROME GPI mannosyltransferase 3 OS=Drosophila melanogaster GN=CG12006 PE=2 SV=2 10 494 4.0E-55
sp|Q92521|PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens GN=PIGB PE=2 SV=1 9 494 6.0E-55
sp|Q9JJQ0|PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus GN=Pigb PE=2 SV=2 2 484 1.0E-54
sp|Q75BG9|GPI10_ASHGO GPI mannosyltransferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI10 PE=3 SV=1 1 567 2.0E-54
sp|Q5AK24|GPI10_CANAL GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI10 PE=3 SV=1 1 482 4.0E-52
sp|P30777|GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI10 PE=1 SV=2 10 567 1.0E-51
sp|Q6CN76|GPI10_KLULA GPI mannosyltransferase 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI10 PE=3 SV=1 10 567 5.0E-51
sp|Q9USN0|GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi10 PE=3 SV=1 10 480 2.0E-43
sp|P86935|GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei GN=GPI10 PE=2 SV=1 9 480 3.0E-29
sp|P86936|GPI10_TRYB2 GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GPI10 PE=3 SV=1 9 480 6.0E-28
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 11 351 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 180 202 22
2 214 236 22
3 270 292 22
4 381 403 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|055130
MNRNTVVSSLLIRICVALFTRTVFQPDEYFQSLEPAFYLVFGYGHLTWEWISETPIRSIIYPALNVPVYWFLKAS
GLAYAGTFGDILLILLPKILHGCFAALTDIWLCELARVTLGNDYVSTAHFLSMSSLFHALALSRSLSNSLETSLS
TVAFAYYPWDASSKLSPQVLYNRQRLWMTLIFSALACLIRPTNAVIWVFLYFRLAWSLRRYPRILGKMLSDASLV
AFTALGSMFILDSLYYSRPLFTPYNFLKTNLSSVSLFYGSSPWHYYLTQAIPILCTTALPFALHGIITTFRQPKH
SSAALGNMLNVILWSISIYSFAGHKEWRFIHPLLPLLHIFAAKSLIDMSLKAQSHVKAKAKAMNARATALIPPLR
RSHLTFLLLSLPASIYVILFYCSGPISVLSYLRSLPVNVTLVDGKQQPQSVGFLMPCHSTPGQAYLHRPTWEVWS
LGCEPPLQGQNLSTYRDQTDIFFASPLTYVTSTFPEVVDTTFPSSPFPASKPGSPSSKLKGTGEEIYAWQHSWPR
HLVFFGTLLQRPGVKELLEEKGYVETYRAGREWEGEGERKGGVRVWSWRD*
Coding >AgabiH97|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACCGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCTATCTTGTTTTCGGTTACGGGCACCTTACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCACATTCGGTGACATTCTACTGATACTTCTACCTAAGATTCTTCACGGCTGCTTTGCC
GCTCTTACGGATATATGGTTGTGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCACATTTC
CTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCGCGGTCACTCTCTAATTCACTAGAGACATCCTTGTCT
ACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCTAAACTGAGCCCACAGGTACTTTACAACAGGCAACGC
CTTTGGATGACACTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGGGTTTTCTTA
TACTTCCGCTTAGCGTGGTCACTACGACGGTATCCTCGTATACTAGGCAAAATGCTTTCTGACGCTTCTTTGGTT
GCTTTCACTGCCCTTGGAAGCATGTTCATACTAGACTCGCTTTATTACAGTCGACCACTCTTCACGCCCTACAAT
TTCCTCAAAACAAATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCC
ATTCCTATCCTTTGCACCACTGCATTACCTTTTGCTCTTCATGGTATCATTACCACTTTTCGACAACCAAAGCAT
AGTAGTGCCGCCCTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAA
GAATGGCGATTCATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCGCTCATCGATATGTCACTC
AAAGCTCAATCCCACGTGAAGGCCAAGGCCAAGGCTATGAATGCTCGTGCCACAGCCCTCATTCCTCCCTTACGT
CGATCTCACCTCACTTTTCTACTCCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTCTATTGTAGTGGTCCC
ATCAGCGTTCTATCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGT
GTAGGTTTCCTCATGCCCTGCCATTCAACGCCAGGTCAGGCATACCTACATAGGCCGACTTGGGAAGTCTGGTCT
CTGGGATGTGAACCTCCTCTCCAAGGTCAGAATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCG
CCGTTGACATACGTCACTTCGACATTCCCCGAAGTTGTAGATACAACATTTCCTTCTTCCCCCTTCCCTGCTTCT
AAACCTGGATCCCCATCTTCAAAACTTAAAGGCACAGGAGAGGAAATATATGCATGGCAACATTCATGGCCGCGT
CACCTTGTTTTCTTTGGTACTCTCCTTCAGAGACCGGGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAA
ACGTATCGTGCGGGACGAGAATGGGAGGGCGAAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGCGAGAC
TGA
Transcript >AgabiH97|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACCGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCTATCTTGTTTTCGGTTACGGGCACCTTACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCACATTCGGTGACATTCTACTGATACTTCTACCTAAGATTCTTCACGGCTGCTTTGCC
GCTCTTACGGATATATGGTTGTGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCACATTTC
CTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCGCGGTCACTCTCTAATTCACTAGAGACATCCTTGTCT
ACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCTAAACTGAGCCCACAGGTACTTTACAACAGGCAACGC
CTTTGGATGACACTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGGGTTTTCTTA
TACTTCCGCTTAGCGTGGTCACTACGACGGTATCCTCGTATACTAGGCAAAATGCTTTCTGACGCTTCTTTGGTT
GCTTTCACTGCCCTTGGAAGCATGTTCATACTAGACTCGCTTTATTACAGTCGACCACTCTTCACGCCCTACAAT
TTCCTCAAAACAAATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCC
ATTCCTATCCTTTGCACCACTGCATTACCTTTTGCTCTTCATGGTATCATTACCACTTTTCGACAACCAAAGCAT
AGTAGTGCCGCCCTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAA
GAATGGCGATTCATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCGCTCATCGATATGTCACTC
AAAGCTCAATCCCACGTGAAGGCCAAGGCCAAGGCTATGAATGCTCGTGCCACAGCCCTCATTCCTCCCTTACGT
CGATCTCACCTCACTTTTCTACTCCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTCTATTGTAGTGGTCCC
ATCAGCGTTCTATCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGT
GTAGGTTTCCTCATGCCCTGCCATTCAACGCCAGGTCAGGCATACCTACATAGGCCGACTTGGGAAGTCTGGTCT
CTGGGATGTGAACCTCCTCTCCAAGGTCAGAATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCG
CCGTTGACATACGTCACTTCGACATTCCCCGAAGTTGTAGATACAACATTTCCTTCTTCCCCCTTCCCTGCTTCT
AAACCTGGATCCCCATCTTCAAAACTTAAAGGCACAGGAGAGGAAATATATGCATGGCAACATTCATGGCCGCGT
CACCTTGTTTTCTTTGGTACTCTCCTTCAGAGACCGGGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAA
ACGTATCGTGCGGGACGAGAATGGGAGGGCGAAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGCGAGAC
TGA
Gene >AgabiH97|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACCGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCTATCTTGTTTTCGGTTACGGGCACCTTACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCACATTCGGTGACATTCTACTGGTAAGTGGGTCATAATTTTGCGTATTGTGGACCTTA
TTTACACAAGAAATCTAGATACTTCTACCTAAGATTCTTCACGGCTGCTTTGCCGCTCTTACGGATATATGGTTG
TGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCAGTATGTCCTATGCCATGCATCGCATAC
AATAAACACTGAAGGCTAATGAACAAAAAGCATTTCCTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCG
CGGTCACTCTCTAATTCACTAGAGACATCCTTGTCTACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCT
AAACTGAGCCCACAGGTACTTTACAACAGGTGTGCCACACTACATATTGTGATGACTTATCTTTCTCAAATGATC
AGGCAACGCCTTTGGATGACACTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGG
GTTTTCTTATACTTCCGCTTAGCGTGGTCACTACGACGGTATCCTCGTATACTAGGCAAAATGCTTTCTGACGCT
TCTTTGGTTGCGTAGGTCGTTTCCCTAGTTGACGCGACACGTCATTAACTCTTGTGATTCATCAGTTTCACTGCC
CTTGGAAGCATGTTCATACTAGACTCGCTTTATTACAGTCGACCACTCTTCACGCCCTACAATTTCCTCAAAACA
AATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCCATTCCTATCCTT
TGCACCACTGCATTACCTTTTGCTCTTCATGGTATCATTACCACTTTTCGACAACCAAAGCATAGTAGTGCCGCC
CTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAAGAATGGCGATTC
ATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCGCTCATCGATATGTCACTCAAAGCTCAATCC
CACGTGAAGGCCAAGGCCAAGGCTATGAATGCTCGTGCCACAGCCCTCATTCCTCCCTTACGTCGATCTCACCTC
ACTTTTCTACTCCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTCTATTGTAGTGGTCCCATCAGCGTTCTA
TCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGTGTAGGTTTCCTC
ATGCCCTGCCATTCAACGCCAGGTCAGGCATACCTACATAGGCCGACTTGGGAAGTCTGGTCTCTGGGATGTGAA
CCTCCTCTCCAGTAAGTTTATTTCGTTCTTGAATCTGCCATCTTAATGCTGACTACAATTCCTTCAGAGGTCAGA
ATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCGCCGTTGACATACGTCACTTCGACATTCCCCG
AAGTTGTAGATACAACATTTCCTTCTTCCCCCTTCCCTGCTTCTAAACCTGGATCCCCATCTTCAAAACTTAAAG
GCACAGGAGAGGAAATATATGCATGGCAACATTCATGGCCGCGTCACCTTGTTTTCTTTGGTACTCTCCTTCAGA
GACCGGGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAAACGTATCGTGCGGGACGAGAATGGGAGGGCG
AAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGCGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail