Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054950
Gene name
Locationscaffold_3:590753..592902
Strand+
Gene length (bp)2149
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.7E-26 62 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 425 7.0E-62
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 70 271 3.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 70 196 1.0E-16
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 70 279 1.0E-13
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 70 279 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 425 7.0E-62
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 70 271 3.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 70 196 1.0E-16
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 70 279 1.0E-13
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 70 279 2.0E-12
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 70 279 2.0E-12
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 70 279 4.0E-12
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 70 196 7.0E-12
sp|O49293|PER13_ARATH Peroxidase 13 OS=Arabidopsis thaliana GN=PER13 PE=3 SV=2 67 300 5.0E-11
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 70 196 4.0E-10
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 70 196 4.0E-10
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 71 196 3.0E-09
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 62 196 6.0E-09
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 70 196 7.0E-09
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 70 234 9.0E-09
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 70 234 1.0E-08
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 70 196 2.0E-08
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 70 255 3.0E-08
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 68 258 4.0E-08
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 68 243 5.0E-08
sp|Q9LNL0|PER8_ARATH Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1 62 196 1.0E-07
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 70 196 1.0E-07
sp|Q93V93|PER44_ARATH Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=2 SV=1 7 196 2.0E-07
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 70 196 2.0E-07
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 68 258 3.0E-07
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 70 196 3.0E-07
sp|Q59X94|CCPR2_CANAL Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP2 PE=3 SV=1 70 196 5.0E-07
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 70 259 8.0E-07
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 70 196 9.0E-07
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 70 255 1.0E-06
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 70 196 1.0E-06
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 70 255 1.0E-06
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 70 270 2.0E-06
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 70 196 3.0E-06
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 70 196 4.0E-06
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 70 255 4.0E-06
sp|Q9SJZ2|PER17_ARATH Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1 67 291 5.0E-06
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 70 196 5.0E-06
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 67 196 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0005488 binding No
GO:0006950 response to stress No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0050896 response to stimulus No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 574 596 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054950
MHLVKKLAPSALLLQAQLSLAAYHWPSPQYDALETFMYEGQRGDGSNLASLVHPCRKRSGTNASVPAQWLRLAFH
DIATYNNDNGTGGLDGSIVYELGREENLSIGFNQSLTDFEAFPNKYVSRADLIALGAIFSVATCQGPTIPFRGGR
IDAWTAGDFGTPLPQDDITTLTDSFKRMGFSPSDMVGLIACGHSIGGVTSADEPDIVPPGNDPSKPTIVDFDSTG
NFDNKVVTEYLDGSTQNPLVVTSNQTLASDLKIFISDANQTIRSFADPNQYNSQCQTLLERMINTVAHGVSLTDE
ITMIPAKVHDVQLTIERNQLVFKSSLRLPQPMGQKLNTQRTVTMFWCDRYGDSADCQGNTKSAQSVKTTQDDPNN
SPITFNMGLFFVHYHFVVPIDSKVSISKFWFEVDEHNGTSAAVYNNGGDDYVVQQDQVILVPTLSSSVMRSNGSY
TQTYTNRVGEFFTKVYNITVAVREGSNPSRVYATAYDSAVANFTYAVNTTFDFTRNSSMSPVGGYEFYSGSVEDS
GHQMTLDTFADVDGTTYTDDFRQTTFLDNSPYNAPSDVATKTSTSSSPVSFVISAPSLIFGLLLILLPLHLL*
Coding >AgabiH97|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTGCTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCACAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTCGCTTTTCAC
GACATTGCCACTTACAATAATGACAACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAG
GAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAGCATTCCCCAACAAATATGTCTCTCGTGCT
GACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGCCGG
ATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGCTTC
AAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACCAGC
GCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACTGGT
AATTTTGATAATAAAGTTGTCACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAA
ACTCTGGCTTCCGATCTCAAAATTTTTATCAGTGATGCCAACCAGACTATCCGCAGTTTCGCCGATCCGAATCAA
TATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTTGCACATGGCGTTTCGCTAACAGATGAA
ATCACAATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAACGCAATCAGCTAGTTTTCAAGTCCAGT
CTTCGACTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAGGTAC
GGAGATTCGGCCGATTGCCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAACAAC
TCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGTGTCG
ATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGATGAC
TACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATCATAT
ACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACCAAGGTCTACAACATCACGGTTGCTGTTCGTGAGGGT
AGCAATCCTTCTCGGGTTTACGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACT
TTTGATTTTACCAGGAATTCTTCCATGTCTCCTGTTGGAGGATATGAGTTCTACTCTGGATCGGTTGAAGATAGT
GGACACCAGATGACGTTGGATACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACG
TTCCTGGACAATTCTCCCTACAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCGTTTCA
TTTGTGATATCGGCGCCCAGTCTAATTTTCGGCCTACTGTTAATACTCTTACCGCTTCATTTGCTCTGA
Transcript >AgabiH97|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTGCTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCACAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTCGCTTTTCAC
GACATTGCCACTTACAATAATGACAACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAG
GAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAGCATTCCCCAACAAATATGTCTCTCGTGCT
GACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGCCGG
ATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGCTTC
AAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACCAGC
GCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACTGGT
AATTTTGATAATAAAGTTGTCACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAA
ACTCTGGCTTCCGATCTCAAAATTTTTATCAGTGATGCCAACCAGACTATCCGCAGTTTCGCCGATCCGAATCAA
TATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTTGCACATGGCGTTTCGCTAACAGATGAA
ATCACAATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAACGCAATCAGCTAGTTTTCAAGTCCAGT
CTTCGACTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAGGTAC
GGAGATTCGGCCGATTGCCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAACAAC
TCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGTGTCG
ATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGATGAC
TACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATCATAT
ACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACCAAGGTCTACAACATCACGGTTGCTGTTCGTGAGGGT
AGCAATCCTTCTCGGGTTTACGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACT
TTTGATTTTACCAGGAATTCTTCCATGTCTCCTGTTGGAGGATATGAGTTCTACTCTGGATCGGTTGAAGATAGT
GGACACCAGATGACGTTGGATACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACG
TTCCTGGACAATTCTCCCTACAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCGTTTCA
TTTGTGATATCGGCGCCCAGTCTAATTTTCGGCCTACTGTTAATACTCTTACCGCTTCATTTGCTCTGA
Gene >AgabiH97|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTGCTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCACAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTCGTGGGTTTC
GATACACTTTCTCGTCATGCTTCGACTTATAACTGAGGATAGGCTTTTCACGACATTGCCACTTACAATAATGAC
AACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAGGAGGTTTGTGGTCACACCTTGTGC
TTACCATAAGAATTGCTAAATCCTTGCATCAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAG
CATTCCCCAACAAATATGTCTCTCGTCAGTATTCGACTCACCAGGAATTCGGCTTTCCTGACTATATCAATAGGT
GCTGACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGC
CGGATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGC
TTCAAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACC
AGCGCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACT
GGTAATTTTGATAATAAAGTGTATGTCAGCGCTCTGGATCCGCGTTTTTATTTGCTGACCAGGAGCTACAGTGTC
ACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAAACTCTGGCTTCCGATCTCAAA
ATTTTTATCAGTGATGCCAACCAGACTATCCGCAGGTGAGCAAGTTGACAGGTTTGTTTGTACTTGCCTAAATCC
TCTGCCAGTTTCGCCGATCCGAATCAATATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTT
GCACATGGCGTTTCGCTAACAGATGAAATCACAATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAA
CGCAATCAGCTAGTTTTCAAGTCCAGTCTTCGAGTACGTCGGTTCTTGATCCTGGTCAGATTTCCACGCTGATGC
AAAAGTCAAGCTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAG
GTACGGAGATTCGGCCGATTGCCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAA
CAACTCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGT
GTCGATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGA
TGACTACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATC
ATATACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACCAAGGTCTACAACATCACGGTTGCTGTGAGTTA
GTCTCTTCACGTTTGCACGACATTATCAACTCAGTATTATCAGGTTCGTGAGGGTAGCAATCCTTCTCGGGTTTA
CGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACTTTTGATTTTACCAGGAATTC
TTCCATGTCTCCTGTTGGAGGATATGAGTTCTACTCTGGATCGGTTGAAGATAGTGGACACCAGATGACGTTGGA
TACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACGTTCCTGGACAATTCTCCCTA
CAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCGTTTCATTTGTGATATCGGCGCCCAG
TCTAATTTTCGGCCTACTGTTAATACTCTTACCGCTTCATTTGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail