Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054890
Gene name
Locationscaffold_3:573324..575979
Strand-
Gene length (bp)2655
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 1.1E-09 661 719

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 627 778 5.0E-16
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 645 778 3.0E-15
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 645 753 3.0E-15
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 645 753 4.0E-15
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 645 753 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 627 778 5.0E-16
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 645 778 3.0E-15
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 645 753 3.0E-15
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 645 753 4.0E-15
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 645 753 5.0E-15
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 645 753 1.0E-14
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 656 753 3.0E-14
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 661 811 3.0E-14
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 649 753 4.0E-13
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 649 753 6.0E-13
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 645 753 6.0E-13
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 649 753 6.0E-13
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 626 753 1.0E-12
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 626 767 3.0E-12
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 649 780 1.0E-11
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 630 781 3.0E-11
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 642 781 7.0E-11
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 642 781 2.0E-10
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 642 781 2.0E-10
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 656 753 3.0E-10
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 645 754 3.0E-10
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 626 781 3.0E-10
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 656 753 5.0E-10
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 626 715 9.0E-10
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 627 781 9.0E-10
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 626 784 3.0E-09
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 626 781 1.0E-08
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 626 781 3.0E-08
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 627 781 3.0E-08
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 632 712 2.0E-07
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 648 804 3.0E-07
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 626 781 5.0E-07
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 626 720 6.0E-07
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 626 720 9.0E-07
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 626 781 9.0E-07
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 626 780 1.0E-06
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 661 780 1.0E-06
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 626 781 3.0E-06
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 626 781 6.0E-06
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 627 777 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054890
MASLLAPSAGQSSRISQVLPTVKCSNCNRPVPLSELGDHICAPQTVSAPSRPPRLASLAAGIPPQRTGTPPVRSP
RSPPHERLPSPFERPPANTTSSGPSFQQRLSPLARNDTATSLQHPQNFQPPATSSLRPPPLMNPYQSTDSRTRAA
SNASVRQPIPAIQTHLVTPPPFASSLGPPPGDIDTQTGGAAGMAGVGRRGFAAAARAAMIVAPSGHMMDTRPNLP
RFLDMNVPARSPDTPPLSAGSGYSSHSPDPISPSPQTDFVPEALSRLQHPAFPPRQSPSPNFANIRKSPAEEFAN
GFGLSPLDRLPLLGNYMNQPPLSTSPESLFSFEQRKSPPREVLQNTGGDTMSSTYPNDGPLSRKDTQNSLKSTTS
NEMAKQSLPPPPTSDSDSECGLAYADSTDDEDEVPQASSSRVSNTTINPESAATKSNHVHFAMPEANKSAPSRQS
AASSYSLASGSETNDTMAKTLRSPPTSPSRLSRTLFGSGLRRSDSGSSDDSRSTYSRVTSMVPMMGPLSKGSMEQ
SMETLMEEAAPDASTADAVKESTSFGNLYFKEKDDSYVENKSHERDNGLATTSGQPHRSNTVQVPPHSPENKPPK
LPTRAKTTNDSTKLPPRNEKARRVRTCLRCQIKVDDGRWIRVDTGGALCETCWKNMYLPKCRRCLLPIEKQAVSS
SDGQLKGKYHKECFNCHVCHKTFPDKSFYVFDGKPLCAYHYHEANRSLCAATRCGQPIEGPCALSHTGDKYHPEH
MTCEHPGLVPCKERLKEYWEINGKMLCEWHAAEASRDQDEEEEWVQTSKAKKRITRFMNLSSMGGSGGEENGDLN
GLL*
Coding >AgabiH97|054890
ATGGCCTCCCTTCTCGCGCCATCCGCGGGCCAGTCTTCCAGGATCTCTCAGGTCCTCCCCACCGTCAAATGTTCG
AACTGCAATAGGCCTGTGCCTCTTTCGGAACTTGGGGATCATATTTGTGCTCCCCAGACAGTGTCTGCGCCCTCG
CGTCCCCCTCGTTTGGCTTCTCTTGCTGCAGGTATTCCACCTCAAAGAACTGGTACTCCACCCGTTCGCTCTCCC
CGCTCTCCACCTCATGAACGTTTACCTTCACCCTTCGAACGACCACCCGCGAATACCACGTCTAGCGGGCCCTCT
TTTCAACAACGGTTGAGTCCGCTAGCCAGAAATGATACCGCGACATCTTTGCAACACCCCCAAAATTTTCAACCA
CCTGCTACTTCATCTCTTAGGCCACCACCCCTTATGAACCCATATCAGTCAACCGATAGTCGAACGCGCGCAGCC
TCGAATGCCTCCGTCCGGCAACCTATCCCTGCAATTCAAACTCATCTTGTAACGCCACCTCCCTTCGCTTCCTCT
CTTGGTCCTCCTCCGGGGGACATTGATACACAAACTGGCGGAGCCGCAGGAATGGCCGGAGTCGGTCGACGCGGT
TTTGCTGCAGCCGCACGCGCTGCAATGATTGTCGCTCCCTCGGGACATATGATGGATACCCGACCCAATCTTCCG
AGATTCCTCGACATGAATGTGCCGGCGCGATCTCCTGATACGCCCCCTCTTTCGGCTGGTTCTGGTTACTCATCT
CACTCTCCTGACCCTATTTCTCCCAGTCCCCAAACTGATTTCGTTCCCGAGGCTCTGTCAAGGCTACAACATCCT
GCTTTTCCTCCACGTCAGTCCCCATCACCGAACTTTGCCAATATCCGGAAATCACCTGCTGAAGAATTTGCAAAC
GGGTTCGGTCTGTCTCCTTTGGATCGCCTACCTCTGCTTGGAAATTACATGAATCAACCTCCCCTAAGCACCAGT
CCAGAATCTCTCTTTTCATTTGAGCAACGGAAATCTCCTCCTCGCGAAGTCCTGCAGAATACCGGGGGAGACACG
ATGAGCTCTACATATCCAAACGATGGACCATTGTCACGTAAGGACACCCAAAACAGCCTCAAGTCTACAACTTCG
AACGAAATGGCGAAGCAGTCGTTACCTCCGCCTCCTACCTCTGATTCTGATTCTGAATGCGGATTGGCTTATGCT
GATTCGACGGATGATGAGGATGAAGTGCCTCAGGCATCGTCGAGTCGCGTGTCGAACACCACCATCAATCCCGAA
TCCGCTGCGACCAAATCCAATCATGTGCATTTTGCCATGCCCGAAGCAAATAAATCGGCCCCTTCACGTCAATCG
GCTGCTTCGTCGTATTCCTTGGCCAGCGGATCTGAGACGAATGATACCATGGCTAAAACTTTGCGTAGTCCTCCG
ACATCACCCAGTAGACTCAGCAGGACGTTATTTGGCTCTGGGCTTCGGAGAAGTGACAGTGGTAGCAGCGACGAC
AGTAGAAGCACCTATTCTAGAGTCACAAGTATGGTCCCGATGATGGGACCTTTAAGCAAAGGTTCCATGGAACAA
TCAATGGAAACCTTGATGGAAGAGGCAGCTCCGGACGCGTCGACGGCGGATGCGGTGAAAGAGAGTACGTCGTTT
GGGAACCTATACTTCAAGGAGAAGGACGACAGTTATGTCGAGAACAAAAGCCACGAAAGAGACAATGGATTGGCA
ACCACGAGTGGCCAACCTCATCGGAGCAATACCGTACAAGTACCACCTCACTCGCCGGAGAATAAGCCTCCAAAA
CTCCCGACGCGAGCGAAAACGACGAACGACTCTACCAAGTTACCGCCTCGCAATGAGAAAGCGCGGAGGGTGAGA
ACTTGTTTGAGGTGTCAGATAAAGGTGGATGATGGGAGGTGGATCAGAGTCGATACGGGAGGAGCATTGTGCGAG
ACGTGCTGGAAAAACATGTATCTGCCGAAGTGTCGCCGTTGCCTGTTACCTATCGAAAAACAGGCTGTTTCTTCG
TCTGATGGTCAGCTGAAAGGTAAGTATCACAAAGAATGTTTCAATTGTCACGTTTGCCATAAAACTTTCCCTGAC
AAATCGTTTTATGTTTTTGACGGCAAACCTTTATGCGCTTATCACTATCACGAAGCCAACCGGTCGTTATGCGCT
GCTACTCGTTGTGGGCAACCTATTGAAGGACCGTGTGCCCTCTCCCATACAGGTGATAAATATCATCCTGAGCAT
ATGACTTGTGAACATCCAGGACTTGTTCCTTGTAAGGAACGATTGAAAGAGTACTGGGAGATCAATGGCAAGATG
TTGTGTGAGTGGCATGCGGCGGAGGCTAGTAGAGATCAAGATGAGGAGGAGGAGTGGGTGCAGACTTCGAAAGCG
AAGAAACGGATAACACGATTTATGAACCTCTCGAGTATGGGAGGGAGTGGTGGGGAAGAGAATGGAGATTTAAAT
GGTCTACTTTGA
Transcript >AgabiH97|054890
ATGGCCTCCCTTCTCGCGCCATCCGCGGGCCAGTCTTCCAGGATCTCTCAGGTCCTCCCCACCGTCAAATGTTCG
AACTGCAATAGGCCTGTGCCTCTTTCGGAACTTGGGGATCATATTTGTGCTCCCCAGACAGTGTCTGCGCCCTCG
CGTCCCCCTCGTTTGGCTTCTCTTGCTGCAGGTATTCCACCTCAAAGAACTGGTACTCCACCCGTTCGCTCTCCC
CGCTCTCCACCTCATGAACGTTTACCTTCACCCTTCGAACGACCACCCGCGAATACCACGTCTAGCGGGCCCTCT
TTTCAACAACGGTTGAGTCCGCTAGCCAGAAATGATACCGCGACATCTTTGCAACACCCCCAAAATTTTCAACCA
CCTGCTACTTCATCTCTTAGGCCACCACCCCTTATGAACCCATATCAGTCAACCGATAGTCGAACGCGCGCAGCC
TCGAATGCCTCCGTCCGGCAACCTATCCCTGCAATTCAAACTCATCTTGTAACGCCACCTCCCTTCGCTTCCTCT
CTTGGTCCTCCTCCGGGGGACATTGATACACAAACTGGCGGAGCCGCAGGAATGGCCGGAGTCGGTCGACGCGGT
TTTGCTGCAGCCGCACGCGCTGCAATGATTGTCGCTCCCTCGGGACATATGATGGATACCCGACCCAATCTTCCG
AGATTCCTCGACATGAATGTGCCGGCGCGATCTCCTGATACGCCCCCTCTTTCGGCTGGTTCTGGTTACTCATCT
CACTCTCCTGACCCTATTTCTCCCAGTCCCCAAACTGATTTCGTTCCCGAGGCTCTGTCAAGGCTACAACATCCT
GCTTTTCCTCCACGTCAGTCCCCATCACCGAACTTTGCCAATATCCGGAAATCACCTGCTGAAGAATTTGCAAAC
GGGTTCGGTCTGTCTCCTTTGGATCGCCTACCTCTGCTTGGAAATTACATGAATCAACCTCCCCTAAGCACCAGT
CCAGAATCTCTCTTTTCATTTGAGCAACGGAAATCTCCTCCTCGCGAAGTCCTGCAGAATACCGGGGGAGACACG
ATGAGCTCTACATATCCAAACGATGGACCATTGTCACGTAAGGACACCCAAAACAGCCTCAAGTCTACAACTTCG
AACGAAATGGCGAAGCAGTCGTTACCTCCGCCTCCTACCTCTGATTCTGATTCTGAATGCGGATTGGCTTATGCT
GATTCGACGGATGATGAGGATGAAGTGCCTCAGGCATCGTCGAGTCGCGTGTCGAACACCACCATCAATCCCGAA
TCCGCTGCGACCAAATCCAATCATGTGCATTTTGCCATGCCCGAAGCAAATAAATCGGCCCCTTCACGTCAATCG
GCTGCTTCGTCGTATTCCTTGGCCAGCGGATCTGAGACGAATGATACCATGGCTAAAACTTTGCGTAGTCCTCCG
ACATCACCCAGTAGACTCAGCAGGACGTTATTTGGCTCTGGGCTTCGGAGAAGTGACAGTGGTAGCAGCGACGAC
AGTAGAAGCACCTATTCTAGAGTCACAAGTATGGTCCCGATGATGGGACCTTTAAGCAAAGGTTCCATGGAACAA
TCAATGGAAACCTTGATGGAAGAGGCAGCTCCGGACGCGTCGACGGCGGATGCGGTGAAAGAGAGTACGTCGTTT
GGGAACCTATACTTCAAGGAGAAGGACGACAGTTATGTCGAGAACAAAAGCCACGAAAGAGACAATGGATTGGCA
ACCACGAGTGGCCAACCTCATCGGAGCAATACCGTACAAGTACCACCTCACTCGCCGGAGAATAAGCCTCCAAAA
CTCCCGACGCGAGCGAAAACGACGAACGACTCTACCAAGTTACCGCCTCGCAATGAGAAAGCGCGGAGGGTGAGA
ACTTGTTTGAGGTGTCAGATAAAGGTGGATGATGGGAGGTGGATCAGAGTCGATACGGGAGGAGCATTGTGCGAG
ACGTGCTGGAAAAACATGTATCTGCCGAAGTGTCGCCGTTGCCTGTTACCTATCGAAAAACAGGCTGTTTCTTCG
TCTGATGGTCAGCTGAAAGGTAAGTATCACAAAGAATGTTTCAATTGTCACGTTTGCCATAAAACTTTCCCTGAC
AAATCGTTTTATGTTTTTGACGGCAAACCTTTATGCGCTTATCACTATCACGAAGCCAACCGGTCGTTATGCGCT
GCTACTCGTTGTGGGCAACCTATTGAAGGACCGTGTGCCCTCTCCCATACAGGTGATAAATATCATCCTGAGCAT
ATGACTTGTGAACATCCAGGACTTGTTCCTTGTAAGGAACGATTGAAAGAGTACTGGGAGATCAATGGCAAGATG
TTGTGTGAGTGGCATGCGGCGGAGGCTAGTAGAGATCAAGATGAGGAGGAGGAGTGGGTGCAGACTTCGAAAGCG
AAGAAACGGATAACACGATTTATGAACCTCTCGAGTATGGGAGGGAGTGGTGGGGAAGAGAATGGAGATTTAAAT
GGTCTACTTTGA
Gene >AgabiH97|054890
ATGGCCTCCCTTCTCGCGCCATCCGCGGGCCAGTCTTCCAGGATCTCTCAGGTCCTCCCCACCGTCAAATGTTCG
AACTGCAATAGGCCTGTGCCTCTTTCGGAACTTGGGGATCATATTTGTGCTCCCCAGACAGTGTCTGCGCCCTCG
CGTCCCCCTCGTTTGGCTTCTCTTGCTGCAGGTATTCCACCTCAAAGAACTGGTACTCCACCCGTTCGCTCTCCC
CGCTCTCCACCTCATGAACGTTTACCTTCACCCTTCGAACGACCACCCGCGAATACCACGTCTAGCGGGCCCTCT
TTTCAACAACGGTTGAGTCCGCTAGCCAGAAATGATACCGCGACATCTTTGCAACACCCCCAAAATTTTCAACCA
CCTGCTACTTCATCTCTTAGGCCACCACCCCTTATGAACCCATATCAGTCAACCGATAGTCGAACGCGCGCAGCC
TCGAATGCCTCCGTCCGGCAACCTATCCCTGCAATTCAAACTCATCTTGTAACGCCACCTCCCTTCGCTTCCTCT
CTTGGTCCTCCTCCGGGGGACATTGATACACAAACTGGCGGAGCCGCAGGAATGGCCGGAGTCGGTCGACGCGGT
TTTGCTGCAGCCGCACGCGCTGCAATGATTGTCGCTCCCTCGGGACATATGATGGATACCCGACCCAATCTTCCG
AGATTCCTCGACATGAATGTGCCGGCGCGATGTAAGTGTTTTACTCCTGCCAAAGCTTTTGAGAGCTCAAACTTA
AGTACCAATGCAGCTCCTGATACGCCCCCTCTTTCGGCTGGTTCTGGTTACTCATCTCACTCTCCTGACCCTATT
TCTCCCAGTCCCCAAACTGATTTCGTTCCCGAGGCTCTGTCAAGGCTACAACATCCTGCTTTTCCTCCACGTCAG
TCCCCATCACCGAACTTTGCCAATATCCGGAAATCACCTGCTGAAGAATTTGCAAACGGGTTCGGTCTGTCTCCT
TTGGATCGCCTACCTCTGCTTGGAAATTACATGAATCAACCTCCCCTAAGCACCAGTCCAGAATCTCTCTTTTCA
TTTGAGCAACGGAAATCTCCTCCTCGCGAAGTCCTGCAGAATACCGGGGGAGACACGATGAGCTCTACATATCCA
AACGATGGACCATTGTCACGTAAGGACACCCAAAACAGCCTCAAGTCTACAACTTCGAACGAAATGGCGAAGCAG
TCGTTACCTCCGCCTCCTACCTCTGATTCTGATTCTGAATGCGGATTGGCTTATGCTGATTCGACGGATGATGAG
GATGAAGTGCCTCAGGCATCGTCGAGTCGCGTGTCGAACACCACCATCAATCCCGAATCCGCTGCGACCAAATCC
AATCATGTGCATTTTGCCATGCCCGAAGCAAATAAATCGGCCCCTTCACGTCAATCGGCTGCTTCGTCGTATTCC
TTGGCCAGCGGATCTGAGACGAATGATACCATGGCTAAAACTTTGCGTAGTCCTCCGACATCACCCAGTAGACTC
AGCAGGACGTTATTTGGCTCTGGGCTTCGGAGAAGTGACAGTGGTAGCAGCGACGACAGTAGAAGCACCTATTCT
AGAGTCACAAGTATGGTCCCGATGATGGGACCTTTAAGCAAAGGTTCCATGGAACAATCAATGGAAACCTTGATG
GAAGAGGCAGCTCCGGACGCGTCGACGGCGGATGCGGTGAAAGAGAGTACGTCGTTTGGGAACCTATACTTCAAG
GAGAAGGACGACAGTTATGTCGAGAACAAAAGCCACGAAAGAGACAATGGATTGGCAACCACGAGTGGCCAACCT
CATCGGAGCAATACCGTACAAGTACCACCTCACTCGCCGGAGAATAAGCCTCCAAAACTCCCGACGCGAGCGAAA
ACGACGAACGACTCTACCAAGTTACCGCCTCGCAATGAGAAAGCGCGGAGGGTGAGAACTTGTTTGAGGTGTCAG
ATAAAGGTGGATGATGGGAGGTGGATCAGAGTCGATACGGGAGGAGCATTGTGCGAGACGTGCTGGAAAAACATG
TATCTGCCGAAGGTTCGTACCAGTTCCTTTTTCACCCTTTGCTTTGTCTGATAAAAATTTACAGTGTCGCCGTTG
CCTGTTACCTATCGAAAAACAGGCTGTTTCTTCGTCTGATGGTCAGCTGAAAGGTAAGTATCACAAAGAATGTTT
CAATTGTCACGTTTGCCATGTAAGCGGTATTTTATGGGTCTGGAGGCTGCACACCGACGCTGATATCAACACTTA
TAGAAAACTTTCCCTGACAAATCGTTTTATGTTTTTGACGGCAAACCTTTATGCGCTTATCACTATCACGAAGCC
AACCGGTCGTTATGCGCTGCTACTCGTTGTGGGCAACCTATTGAAGGACCGTGTGCCCTCTCCCATACAGGTGAT
AAATATCATCCTGAGCATATGACTTGTGAACATCCAGGACTTGTTCCTTGTAAGGAACGATTGAAAGAGTACTGG
GAGATCAATGGCAAGATGTTGTGTGAGTGGCATGCGGCGGAGGCTAGTAGAGATCAAGATGAGGAGGAGGAGTGG
GTGCAGACTTCGAAAGCGAAGAAACGGATAACACGATTTATGAACCTCTCGAGTATGGGAGGGAGTGGTGGGGAA
GAGAATGGAGATTTAAATGGTCTACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail