Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054730
Gene name
Locationscaffold_3:541059..542351
Strand+
Gene length (bp)1292
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 36 281 8.0E-31
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 50 281 3.0E-28
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 36 244 1.0E-24
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 36 284 5.0E-22
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 31 285 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 36 281 8.0E-31
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 50 281 3.0E-28
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 36 244 1.0E-24
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 36 284 5.0E-22
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 31 285 1.0E-20
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 36 285 2.0E-20
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 36 285 2.0E-20
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 36 284 6.0E-20
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 36 284 4.0E-18
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 36 285 1.0E-16
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 36 285 1.0E-16
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 54 270 3.0E-16
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 36 249 1.0E-14
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 39 249 2.0E-13
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 35 249 5.0E-13
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 34 249 1.0E-12
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 35 249 3.0E-11
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 35 249 3.0E-11
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 35 249 3.0E-11
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 43 249 5.0E-11
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 60 291 7.0E-10
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 39 286 8.0E-09
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 67 279 2.0E-08
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 61 270 4.0E-08
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 61 291 1.0E-07
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 61 291 1.0E-07
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 67 281 2.0E-06
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 67 281 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054730
MMLTTNIILSLVFLSVTFAANNFVGLTASNAIGGRSPYTCRTQAQWNDLANTARNSGFKTIRILGFDCGALNMAS
SAAAAANLQVLAGIFFDGSVAGANGQIDNEVRSFQSAVQQFGASRYVGLTIGNENSDDPNNIINKVNQVRNTLRS
AGINTPVSTVHSWFNIINARVLCNGDFVGANAHAFFDPNTAAGNSGNFLTQTVIPALRNACGNKKIMITETGWPS
RGGSNGAGVASLDNERAALAALNCASGSIPDVSVFAFEYDDQTWKGNDNERSFGIFPKFNNGVPSC*
Coding >AgabiH97|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGTATTCCTCTCTGTGACTTTCGCGGCCAACAATTTCGTAGGC
CTTACGGCTTCGAATGCGATTGGGGGTAGGTCTCCATACACTTGCCGTACCCAGGCTCAGTGGAACGACCTTGCC
AATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGCTTCT
AGCGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGGTTCTGTTGCCGGTGCAAATGGT
CAGATCGATAACGAAGTTCGCTCGTTCCAGAGCGCTGTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACC
ATTGGCAACGAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCAAGTTCGAAACACTCTGAGATCT
GCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGTAACGGC
GATTTTGTAGGCGCCAATGCACACGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACG
CAAACGGTCATCCCTGCGCTGCGAAATGCATGCGGTAACAAGAAAATCATGATTACGGAAACTGGTTGGCCTTCC
CGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCCTAGATAATGAACGCGCGGCGCTTGCTGCATTGAACTGCGCC
AGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTTTCGAATACGATGATCAAACCTGGAAAGGTAACGATAATGAA
CGGAGTTTTGGTATCTTCCCCAAGTTTAACAATGGGGTTCCGTCTTGTTGA
Transcript >AgabiH97|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGTATTCCTCTCTGTGACTTTCGCGGCCAACAATTTCGTAGGC
CTTACGGCTTCGAATGCGATTGGGGGTAGGTCTCCATACACTTGCCGTACCCAGGCTCAGTGGAACGACCTTGCC
AATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGCTTCT
AGCGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGGTTCTGTTGCCGGTGCAAATGGT
CAGATCGATAACGAAGTTCGCTCGTTCCAGAGCGCTGTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACC
ATTGGCAACGAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCAAGTTCGAAACACTCTGAGATCT
GCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGTAACGGC
GATTTTGTAGGCGCCAATGCACACGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACG
CAAACGGTCATCCCTGCGCTGCGAAATGCATGCGGTAACAAGAAAATCATGATTACGGAAACTGGTTGGCCTTCC
CGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCCTAGATAATGAACGCGCGGCGCTTGCTGCATTGAACTGCGCC
AGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTTTCGAATACGATGATCAAACCTGGAAAGGTAACGATAATGAA
CGGAGTTTTGGTATCTTCCCCAAGTTTAACAATGGGGTTCCGTCTTGTTGA
Gene >AgabiH97|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGTATTCCTCTCTGTGACTTTCGCGGCCAACAATTTCGTAGGC
CTTACGGCTTCGAATGCGATTGGGGGTAGGTCTCCATACACTTGCCGTACCCAGGCTCAGGTGATTTTCACTGCA
TCATTTCTTAGAAGCGCTCATGATCACTGATAATCTACTCGCGCTGATCGTGTGTCATTGATAGTGGAACGACCT
TGCCAATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGC
TTCTAGCGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGTAGATACTTTTATTTCTCC
CGGCTATATGCGATATTGAACTATGGTTTTAGGGTTCTGTTGCCGGTGCAAATGGTCAGATCGAGTAAGTCACAC
TGCTACTTAGTTTTTGTTGTCTGGCGGGTTTACTGAGTGATCAATAGTAACGAAGTTCGCTCGTTCCAGAGCGCT
GTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACCATTGGCAACGAGGCAAGACCCATTTCACCTTGAACA
CTTCCGAATCATACTCACGAAATGTCGAACCTAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCA
AGTTCGAAGTAGGTGACATTTTTGCTTTAGTCGGGTATATATGCCAATCGCTCTTTCCTGTTTCTAGACACTCTG
AGATCTGCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGT
AACGGCGATTTTGTAGGCGCCAATGCACAGTAAGTATTACTCCATCAATACGGCGTTTCACGCTCACGTCGTGGA
TAATGCACAGCGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACGCAAACGGTCATCC
CTGCGCTGCGAAATGCATGCGGTAACAAGAAAATCATGATTACGGAGTACGTATCTTTCTACTCAACTTGCATAT
GCATAATCGAACTTCAATACTATAGAACTGGTTGGCCTTCCCGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCC
TAGATAATGAACGCGCGGCGCTTGCTGCATTGAACTGCGCCAGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTT
TCGAATACGATGATCAAACCTGGAAAGGTAACGATAATGAACGGAGTTTTGGTATCTTCCCCAAGTTTAACAATG
GGGTTCCGTCTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail