Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054720
Gene name
Locationscaffold_3:538010..540497
Strand+
Gene length (bp)2487
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.2E-19 155 430

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 138 445 2.0E-13
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 163 553 1.0E-12
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 174 532 8.0E-07

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 78 97 19
2 154 176 22
3 185 207 22
4 212 234 22
5 254 276 22
6 282 304 22
7 375 397 22
8 412 434 22
9 469 491 22
10 501 523 22
11 530 552 22
12 562 579 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054720
MPSLSSPSRKAVSKHRDLLGRSFTDESEELVYEEADELLHHFAHPERQTTDDTLIGEVIDEEEEAKIKKLPWWKR
PSPYWLLCVLPFTAVAMTALLAPRVEIYTILVCRQIKPDIYYEKSSLAGTALLSSSASTPTRSQLCAADPVVQAG
VSKFATMMTTSMGILSCLSTGWWSAFSDRYGRCRVMGISVIGLLLTDLNFIFIVSLTERFPGAYWILLLGPILEG
CLGGFTSAAAAIHAYQADVVDEHRRSRFFSLVLGLLFVGMAVGPTLGSLVIRSTGRLISIFYVSTGIHFLYALFV
WFILPESLSLSHRLRAREKYAQRLRTDVSEDTGSLGIRTLNAVKKLFGFLAPLNVFFPEVREMNDNPLKKKRNWN
LTLVGLAYFMVTSLMGIYTYAFQYAALTFGWTSETLGYWLSLVSGAKAFFLAAILPLAIKLFKPKPKVVEMPSEI
VPLLSSSGYRSSSKLLVSWMLWSMGAAFTPANQAVALALFTERGGTETGRLFGALSVLQSLGSQILGPSLFAFIY
MKTVATYPRTIFFVAVGAVVVSATLLAFNHFKSHRRTGLILFCFVLLSLSSSLLL*
Coding >AgabiH97|054720
ATGCCTTCTTTGTCGAGTCCGTCTCGCAAAGCTGTCTCGAAACATCGCGACTTGCTTGGTAGATCGTTTACAGAT
GAATCCGAGGAACTCGTATATGAAGAGGCTGACGAACTACTCCACCACTTCGCGCACCCAGAGCGTCAGACAACG
GACGACACCCTTATAGGGGAGGTAATTGATGAAGAGGAAGAGGCGAAAATAAAGAAACTTCCATGGTGGAAGCGA
CCTTCTCCCTATTGGTTACTGTGTGTGTTGCCGTTCACAGCCGTAGCCATGACAGCATTACTCGCGCCACGCGTT
GAAATATATACCATTCTCGTATGCCGACAAATAAAACCCGACATTTACTACGAGAAATCATCGTTAGCGGGTACT
GCCCTCTTGTCTTCCTCAGCGTCGACCCCGACGCGCTCTCAGTTATGTGCCGCCGACCCGGTTGTCCAGGCTGGG
GTTTCGAAGTTTGCAACTATGATGACAACATCCATGGGTATCCTCAGTTGCCTGTCCACCGGTTGGTGGAGTGCT
TTCTCTGATCGTTATGGCCGGTGCCGTGTGATGGGAATTTCGGTGATTGGCCTGCTTTTAACAGATCTCAACTTC
ATCTTTATCGTCTCCCTCACGGAACGGTTTCCGGGCGCTTATTGGATTCTCTTGCTCGGACCTATTCTGGAAGGA
TGCCTTGGAGGTTTCACAAGTGCTGCTGCTGCTATCCATGCATATCAAGCCGATGTCGTCGATGAACACAGAAGA
TCACGCTTTTTCTCCCTCGTTTTAGGCCTACTGTTCGTCGGGATGGCTGTCGGGCCAACTTTGGGTTCGCTTGTG
ATTCGATCCACTGGACGGCTGATATCCATTTTCTACGTCTCCACGGGAATACACTTCCTATATGCGCTCTTTGTC
TGGTTTATTCTACCAGAGTCACTGAGTTTGTCTCATCGACTTCGAGCTAGAGAGAAATATGCACAGCGGCTGCGC
ACGGACGTTTCTGAGGATACTGGTTCTCTGGGTATTCGAACACTCAATGCGGTCAAGAAACTGTTTGGCTTCCTC
GCTCCGCTTAATGTCTTCTTCCCTGAGGTGAGGGAAATGAACGACAACCCTCTCAAGAAAAAGAGAAATTGGAAT
TTGACCTTGGTGGGTCTCGCATATTTTATGGTGACCTCCCTTATGGGCATCTATACGTATGCGTTCCAATATGCC
GCTTTAACTTTCGGGTGGACCTCGGAAACTCTAGGATACTGGTTGAGTTTGGTTAGCGGCGCAAAGGCCTTCTTT
TTGGCTGCTATCTTACCTTTGGCAATCAAACTGTTTAAGCCAAAACCGAAGGTCGTAGAGATGCCCTCGGAAATT
GTGCCACTGCTGTCGTCCTCCGGATATCGCTCCTCATCGAAATTGTTGGTTTCATGGATGCTCTGGTCTATGGGA
GCGGCTTTCACCCCTGCGAATCAGGCGGTTGCGCTAGCCCTATTTACCGAGCGTGGAGGCACGGAAACAGGCAGA
CTTTTTGGAGCTCTGAGTGTTCTACAATCCCTCGGCTCCCAGATTCTAGGGCCTTCCCTTTTTGCCTTCATCTAT
ATGAAGACCGTCGCAACATATCCTAGAACCATCTTCTTTGTGGCCGTTGGCGCGGTAGTCGTGTCTGCGACACTT
CTTGCCTTTAACCATTTTAAATCACACCGACGGACCGGCTTGATACTTTTTTGCTTCGTACTTTTATCTTTGTCT
TCTTCGCTATTGTTATGA
Transcript >AgabiH97|054720
ATGCCTTCTTTGTCGAGTCCGTCTCGCAAAGCTGTCTCGAAACATCGCGACTTGCTTGGTAGATCGTTTACAGAT
GAATCCGAGGAACTCGTATATGAAGAGGCTGACGAACTACTCCACCACTTCGCGCACCCAGAGCGTCAGACAACG
GACGACACCCTTATAGGGGAGGTAATTGATGAAGAGGAAGAGGCGAAAATAAAGAAACTTCCATGGTGGAAGCGA
CCTTCTCCCTATTGGTTACTGTGTGTGTTGCCGTTCACAGCCGTAGCCATGACAGCATTACTCGCGCCACGCGTT
GAAATATATACCATTCTCGTATGCCGACAAATAAAACCCGACATTTACTACGAGAAATCATCGTTAGCGGGTACT
GCCCTCTTGTCTTCCTCAGCGTCGACCCCGACGCGCTCTCAGTTATGTGCCGCCGACCCGGTTGTCCAGGCTGGG
GTTTCGAAGTTTGCAACTATGATGACAACATCCATGGGTATCCTCAGTTGCCTGTCCACCGGTTGGTGGAGTGCT
TTCTCTGATCGTTATGGCCGGTGCCGTGTGATGGGAATTTCGGTGATTGGCCTGCTTTTAACAGATCTCAACTTC
ATCTTTATCGTCTCCCTCACGGAACGGTTTCCGGGCGCTTATTGGATTCTCTTGCTCGGACCTATTCTGGAAGGA
TGCCTTGGAGGTTTCACAAGTGCTGCTGCTGCTATCCATGCATATCAAGCCGATGTCGTCGATGAACACAGAAGA
TCACGCTTTTTCTCCCTCGTTTTAGGCCTACTGTTCGTCGGGATGGCTGTCGGGCCAACTTTGGGTTCGCTTGTG
ATTCGATCCACTGGACGGCTGATATCCATTTTCTACGTCTCCACGGGAATACACTTCCTATATGCGCTCTTTGTC
TGGTTTATTCTACCAGAGTCACTGAGTTTGTCTCATCGACTTCGAGCTAGAGAGAAATATGCACAGCGGCTGCGC
ACGGACGTTTCTGAGGATACTGGTTCTCTGGGTATTCGAACACTCAATGCGGTCAAGAAACTGTTTGGCTTCCTC
GCTCCGCTTAATGTCTTCTTCCCTGAGGTGAGGGAAATGAACGACAACCCTCTCAAGAAAAAGAGAAATTGGAAT
TTGACCTTGGTGGGTCTCGCATATTTTATGGTGACCTCCCTTATGGGCATCTATACGTATGCGTTCCAATATGCC
GCTTTAACTTTCGGGTGGACCTCGGAAACTCTAGGATACTGGTTGAGTTTGGTTAGCGGCGCAAAGGCCTTCTTT
TTGGCTGCTATCTTACCTTTGGCAATCAAACTGTTTAAGCCAAAACCGAAGGTCGTAGAGATGCCCTCGGAAATT
GTGCCACTGCTGTCGTCCTCCGGATATCGCTCCTCATCGAAATTGTTGGTTTCATGGATGCTCTGGTCTATGGGA
GCGGCTTTCACCCCTGCGAATCAGGCGGTTGCGCTAGCCCTATTTACCGAGCGTGGAGGCACGGAAACAGGCAGA
CTTTTTGGAGCTCTGAGTGTTCTACAATCCCTCGGCTCCCAGATTCTAGGGCCTTCCCTTTTTGCCTTCATCTAT
ATGAAGACCGTCGCAACATATCCTAGAACCATCTTCTTTGTGGCCGTTGGCGCGGTAGTCGTGTCTGCGACACTT
CTTGCCTTTAACCATTTTAAATCACACCGACGGACCGGCTTGATACTTTTTTGCTTCGTACTTTTATCTTTGTCT
TCTTCGCTATTGTTATGA
Gene >AgabiH97|054720
ATGCCTTCTTTGTCGAGTCCGTCTCGCAAAGCTGTCTCGAAACATCGCGACTTGCTTGGTAGATCGTTTACAGAT
GAATCCGAGGAACTCGTATATGAAGAGGCTGACGAACTACTCCACCACTTCGCGCACCCAGAGCGTCAGACAACG
GACGACACCCTTATAGGGGAGGTAATTGATGAAGAGGAAGAGGCGAAAATAAAGAAACTTCCATGGTGGAAGCGA
CCTTCTCCCTATTGGTAGGGATTTCAATGTTTGTCGTTGCGGAGGGTTCTCTTAAATTGCGATTTCAGGTTACTG
TGTGTGTTGCCGTTCACAGCCGTAGCCATGACAGCATTACTCGCGCCACGCGTTGAAATATATACCATTCTCGTA
TGCCGACAAATAAAACCCGACATTTACTACGAGAAATCATCGTTAGCGGGTACTGCCCTCTTGTCTTCCTCAGCG
TCGACCCCGACGCGCTCTCAGTTATGTGCCGCCGACCCGGTTGTCCAGGCTGGGGTTTCGAAGTTTGCAACTAGT
ACGTCATTTTCTGCCAGGGACAACTACACACCGTCCTGCATCGCACTGCCCAGCTTACCGCCCCACGCAGTGATG
ACAACATCCATGGGTATCCTCAGTTGCCTGTCCACCGGTTGGTGGAGTGCTGTGAGATACCTTGCTACTGCCTCG
TTGTCGTACTTAATTTAGGTGTTAGTTCTCTGATCGTTATGGCCGGTGCCGTGTGATGGGAATTTCGGTGATTGG
CCTGCTTTTAACAGATCTCAACTTCATCTTTATCGTCTCCCTCACGGAACGGTTTCCGGGCGCTTATTGGATTCT
CTTGCTCGGACCTATTCTGGAAGGATGCCTTGGAGGTAGTTCTAAGCCTGCATCATAATGCATGTGTTCATTATC
TCCTAGGTTTCACAAGTGCTGCTGCTGCTATCCATGCATATCAAGCCGATGTCGTCGATGAACACAGAAGGTATA
CTTTGCTCAAGTTCTTTCCTCGTTAACACTAATACGCGTGCCTAGATCACGCTTTTTCTCCCTCGTTTTAGGCCT
ACTGTTCGTCGGGATGGCTGTCGGGCCAACTTTGGGTTCGCTTGTGATTCGATCCACTGGACGGCTGATATCCAT
TTTCTACGTCTCCACGGGAATACACTTCCTATATGCGCTCTTTGTCTGGTTTATTCTACCAGAGTCACTGAGTTT
GTCTCATCGACTTCGAGCTAGAGAGAAATATGCACAGCGGCTGCGCACGGACGTTTCTGAGGATACTGGTTCTCT
GGGTATTCGAACACTCAATGCGGTCAAGAAACTGTTTGGCTTCCTCGCTCCGCTTAATGTCTTCTTCCCTGAGGT
GAGGGAAATGAACGACAACCCTCTCAAGAAAAAGAGAAATTGGAATTTGACCTTGGTGGGTCTCGCATATTTTAT
GGTGACCTCCCTTATGGTTCGTGATTTCGTTTTCTGTTCTGGGACCACTTCAATGACATTGATATATGTATCAGG
GCATCTATACGTATGCGTTCCAATATGCCGCTTTAACTTTCGGGTGGACCTCGGAAACTGTGAGTTCTCGTTCCG
AAGCCCCCGTCAACTCTTGAACGGGAACAAAGCTAGGATACTGGTTGAGTTTGGTTAGCGGCGCAAAGGCCTTCT
TTTTGGCTGCTATCTTACCTTGTGAGTGTATGCTATAGGTTTGCTGCATCAGTCAGTGACAGTTGATACAGTGGC
AATCAAACTGTTTAAGCCAAAACCGAAGGTCGTAGAGATGCCCTCGGAAATTGTGCCACTGCTGTCGTCCTCCGG
TCAGAAAAACCTCAAAAAGAAGGAAATTCACTCACTTGCTTTCGACCTGAATTTGGCCAGGATATCGCTCCTCAT
CGAAATTGTTGGTTTCATGTGCATGGGATTTGCACTTACTCCTATCGCGTTCACCGCATCAGGGATGCTCTGGTC
TATGGGAGCGGCTTTCACCCCTGCGAATCAGGCGGTTGCGCTAGCCCTATTTACCGAGCGTGGAGGCACGGAAAC
AGGCAGACTTTTTGGAGCTCTGAGTGTTCTACAATCCCTCGGGTGTGTTATGAGCCGATAACTCAAGTTCTTTGT
CCGCTAATGTACATCTAAACAGCTCCCAGATTCTAGGGCCTTCCCTTTTTGCCTTCATCTATATGAAGACCGTCG
CAACATATCCTAGAACCATCTTCTTTGTGGCCGTTGGCGCGGTAGTCGTGTCTGCGACACTTCTTGCCTTTGTCC
GCTTGCCGAATGAGCACGATCACTCTCATGCGACGTTGGTCGCAGAAGAGTCTGATATATCAAGTGGAAGCAGTG
CTAGAACCATTTTAAATCACACCGACGGACCGGCTTGATACTTTTTTGCTTCGTACTTTGTAAGGTCATTTCTCA
ATGGGGTTTGGATACCGCCCTCCGAATTCTTCTGACTATGATGAGTTGTCTATCGCAGTATCTTTGTCTTCTTCG
CTATTGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail