Protein ID | AgabiH97|054560 |
Gene name | |
Location | scaffold_3:504212..504909 |
Strand | + |
Gene length (bp) | 697 |
Transcript length (bp) | 471 |
Coding sequence length (bp) | 471 |
Protein length (aa) | 157 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00085 | Thioredoxin | Thioredoxin | 2.5E-20 | 51 | 154 |
PF13098 | Thioredoxin_2 | Thioredoxin-like domain | 2.2E-07 | 60 | 153 |
PF13728 | TraF | F plasmid transfer operon protein | 3.3E-05 | 42 | 134 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4L5F0|THIO_STAHJ | Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-17 |
sp|Q8CPL5|THIO_STAES | Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 | 62 | 155 | 2.0E-17 |
sp|Q5HQ29|THIO_STAEQ | Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 | 62 | 155 | 2.0E-17 |
sp|P0AGG7|THIO2_SHIFL | Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 | 48 | 154 | 4.0E-17 |
sp|P0AGG4|THIO2_ECOLI | Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 | 48 | 154 | 4.0E-17 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4L5F0|THIO_STAHJ | Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-17 |
sp|Q8CPL5|THIO_STAES | Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 | 62 | 155 | 2.0E-17 |
sp|Q5HQ29|THIO_STAEQ | Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 | 62 | 155 | 2.0E-17 |
sp|P0AGG7|THIO2_SHIFL | Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 | 48 | 154 | 4.0E-17 |
sp|P0AGG4|THIO2_ECOLI | Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 | 48 | 154 | 4.0E-17 |
sp|P0AGG5|THIO2_ECOL6 | Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 | 48 | 154 | 4.0E-17 |
sp|P0AGG6|THIO2_ECO57 | Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 | 48 | 154 | 4.0E-17 |
sp|Q49WR2|THIO_STAS1 | Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 | 62 | 155 | 7.0E-17 |
sp|P0A0K5|THIO_STAAW | Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|P0A0K6|THIO_STAAU | Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q6GA69|THIO_STAAS | Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q6GHU0|THIO_STAAR | Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|P99122|THIO_STAAN | Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 | 62 | 155 | 1.0E-16 |
sp|P0A0K4|THIO_STAAM | Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q5HGT9|THIO_STAAC | Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q2YXD0|THIO_STAAB | Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q2FZD2|THIO_STAA8 | Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q2FHT6|THIO_STAA3 | Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 | 62 | 155 | 1.0E-16 |
sp|Q7M1B9|THIO_CHLAA | Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 | 50 | 156 | 2.0E-16 |
sp|Q9R6P9|THIO_MYCGA | Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 | 61 | 153 | 3.0E-16 |
sp|P9WG67|THIO_MYCTU | Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 | 61 | 143 | 1.0E-15 |
sp|P9WG66|THIO_MYCTO | Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 | 61 | 143 | 1.0E-15 |
sp|P0A617|THIO_MYCBO | Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 | 61 | 143 | 1.0E-15 |
sp|P66928|THIO_HELPY | Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 | 46 | 156 | 1.0E-15 |
sp|P66929|THIO_HELPJ | Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 | 46 | 156 | 1.0E-15 |
sp|P50254|THIO_PYRYE | Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 | 61 | 155 | 1.0E-15 |
sp|P51225|THIO_PORPU | Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 | 66 | 155 | 2.0E-15 |
sp|P07887|THIO2_CORNE | Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 | 66 | 155 | 3.0E-15 |
sp|P12243|THIO1_SYNE7 | Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 | 66 | 155 | 3.0E-15 |
sp|P14949|THIO_BACSU | Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 | 60 | 155 | 3.0E-15 |
sp|P0A4L2|THIO1_NOSSO | Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 | 66 | 155 | 5.0E-15 |
sp|P0A4L1|THIO1_NOSS1 | Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 | 66 | 155 | 5.0E-15 |
sp|Q5JMR9|TRXY_ORYSJ | Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 | 60 | 154 | 5.0E-15 |
sp|Q8L7S9|TRXY2_ARATH | Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 | 60 | 149 | 7.0E-15 |
sp|Q9UW02|THIO_COPCM | Thioredoxin OS=Coprinus comatus PE=1 SV=1 | 63 | 145 | 1.0E-14 |
sp|Q9CM49|THIO_PASMU | Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 | 66 | 155 | 1.0E-14 |
sp|P97615|THIOM_RAT | Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 | 34 | 156 | 2.0E-14 |
sp|O22022|THIO_CYAME | Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 | 53 | 155 | 2.0E-14 |
sp|P23400|TRXM_CHLRE | Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 | 16 | 155 | 3.0E-14 |
sp|P37395|THIO_CYACA | Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 | 64 | 155 | 3.0E-14 |
sp|O30974|THIO_MYCSM | Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 | 61 | 143 | 5.0E-14 |
sp|P0AA30|THIO_SHIFL | Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 | 63 | 154 | 7.0E-14 |
sp|P0AA28|THIO_SALTY | Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 | 63 | 154 | 7.0E-14 |
sp|P0AA29|THIO_SALTI | Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 | 63 | 154 | 7.0E-14 |
sp|P0AA25|THIO_ECOLI | Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 | 63 | 154 | 7.0E-14 |
sp|P0AA26|THIO_ECOL6 | Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 | 63 | 154 | 7.0E-14 |
sp|P0AA27|THIO_ECO57 | Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 | 63 | 154 | 7.0E-14 |
sp|P22803|TRX2_YEAST | Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 | 61 | 153 | 7.0E-14 |
sp|Q9RD25|THIO2_STRCO | Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 | 61 | 155 | 7.0E-14 |
sp|Q05739|THIO_STRC2 | Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 | 42 | 149 | 8.0E-14 |
sp|P00275|THIO1_CORNE | Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 | 66 | 149 | 9.0E-14 |
sp|Q9Z7P5|THIO_CHLPN | Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 | 65 | 155 | 1.0E-13 |
sp|P22217|TRX1_YEAST | Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 | 61 | 153 | 1.0E-13 |
sp|P46843|TRXB_MYCLE | Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 | 61 | 149 | 1.0E-13 |
sp|Q6NPF9|TRXY1_ARATH | Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 | 63 | 156 | 2.0E-13 |
sp|P0A4L3|THIO_LISMO | Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 | 59 | 155 | 3.0E-13 |
sp|P0A4L4|THIO_LISIN | Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 | 59 | 155 | 3.0E-13 |
sp|O83889|THIO_TREPA | Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 | 63 | 142 | 3.0E-13 |
sp|Q95108|THIOM_BOVIN | Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 | 62 | 156 | 4.0E-13 |
sp|P97493|THIOM_MOUSE | Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 | 62 | 156 | 5.0E-13 |
sp|Q17424|THIO2_CAEEL | Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 | 2 | 154 | 5.0E-13 |
sp|Q99757|THIOM_HUMAN | Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 | 66 | 156 | 5.0E-13 |
sp|P52230|THIO1_STRCO | Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 | 62 | 146 | 6.0E-13 |
sp|P52232|THIO1_SYNY3 | Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 | 66 | 142 | 7.0E-13 |
sp|O94504|TRX2_SCHPO | Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 | 33 | 143 | 7.0E-13 |
sp|P33791|THIO_STRAU | Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 | 63 | 154 | 8.0E-13 |
sp|Q9ZP20|TRXM5_ORYSJ | Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 | 66 | 155 | 1.0E-12 |
sp|O84544|THIO_CHLTR | Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 | 65 | 142 | 1.0E-12 |
sp|Q7KQL8|THIO_PLAF7 | Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 | 61 | 155 | 1.0E-12 |
sp|P10472|THIO_CHLTI | Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 | 63 | 155 | 1.0E-12 |
sp|Q8KE49|THIO2_CHLTE | Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 | 42 | 155 | 2.0E-12 |
sp|O17486|THIO_ECHGR | Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 | 40 | 143 | 2.0E-12 |
sp|P48384|TRXM_PEA | Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 | 66 | 155 | 3.0E-12 |
sp|P59527|THIO_BUCBP | Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 | 47 | 154 | 3.0E-12 |
sp|P52231|THIO_SYNY3 | Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 | 66 | 155 | 3.0E-12 |
sp|Q6H7E4|TRXM1_ORYSJ | Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 | 21 | 155 | 4.0E-12 |
sp|P07591|TRXM_SPIOL | Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 | 66 | 155 | 4.0E-12 |
sp|Q9ZP21|TRXM_WHEAT | Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 | 66 | 155 | 5.0E-12 |
sp|O51088|THIO_BORBU | Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 | 63 | 153 | 1.0E-11 |
sp|P29447|THIO3_DICDI | Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 | 55 | 143 | 1.0E-11 |
sp|O14463|TRX1_SCHPO | Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 | 62 | 145 | 1.0E-11 |
sp|Q9PJK3|THIO_CHLMU | Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 | 65 | 142 | 2.0E-11 |
sp|P50338|THIO_GRIPA | Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 | 55 | 155 | 2.0E-11 |
sp|Q41864|TRXM_MAIZE | Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 | 66 | 155 | 2.0E-11 |
sp|P52233|THIO_ACIFR | Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 | 57 | 154 | 2.0E-11 |
sp|Q1RKN1|THIO_RICBR | Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 | 66 | 142 | 2.0E-11 |
sp|Q8IFW4|THIOT_DROME | Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 | 45 | 143 | 2.0E-11 |
sp|Q9SEU6|TRXM4_ARATH | Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 | 66 | 156 | 2.0E-11 |
sp|P80579|THIO_ALIAC | Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 | 63 | 156 | 2.0E-11 |
sp|P75512|THIO_MYCPN | Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 | 61 | 155 | 2.0E-11 |
sp|P57653|THIO_BUCAI | Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 | 67 | 155 | 3.0E-11 |
sp|P52227|THIO_CHLCV | Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 | 65 | 142 | 4.0E-11 |
sp|P10473|THIO_RHORU | Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 | 68 | 149 | 6.0E-11 |
sp|P08058|THIO_RHOSH | Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 | 66 | 149 | 7.0E-11 |
sp|P43785|THIO_HAEIN | Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 | 66 | 155 | 1.0E-10 |
sp|Q6XHI1|THIO2_DROYA | Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 | 60 | 143 | 1.0E-10 |
sp|P77395|YBBN_ECOLI | Uncharacterized protein YbbN OS=Escherichia coli (strain K12) GN=ybbN PE=1 SV=2 | 48 | 156 | 2.0E-10 |
sp|Q9X2T1|THIO_PSEAE | Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 | 66 | 154 | 2.0E-10 |
sp|Q9V429|THIO2_DROME | Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 | 58 | 143 | 2.0E-10 |
sp|P29445|THIO1_DICDI | Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 | 53 | 143 | 3.0E-10 |
sp|Q9XGS0|TRXM_BRANA | Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 | 30 | 156 | 3.0E-10 |
sp|Q39239|TRXH4_ARATH | Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 | 59 | 146 | 3.0E-10 |
sp|Q7XKD0|TRXX_ORYSJ | Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 | 66 | 156 | 4.0E-10 |
sp|Q39362|TRXH2_BRANA | Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 | 63 | 146 | 4.0E-10 |
sp|P29446|THIO2_DICDI | Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 | 55 | 140 | 5.0E-10 |
sp|Q09433|THIO1_CAEEL | Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 | 55 | 156 | 5.0E-10 |
sp|Q38879|TRXH2_ARATH | Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 | 58 | 152 | 5.0E-10 |
sp|Q5WNE3|NGLY1_CAEBR | Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 | 52 | 143 | 6.0E-10 |
sp|O51890|THIO_BUCAP | Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 | 66 | 155 | 6.0E-10 |
sp|Q7XQQ2|TRXM3_ORYSJ | Thioredoxin M3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0430800 PE=2 SV=4 | 66 | 146 | 6.0E-10 |
sp|P47370|THIO_MYCGE | Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 | 61 | 149 | 9.0E-10 |
sp|P08629|THIO_CHICK | Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 | 45 | 146 | 9.0E-10 |
sp|Q851R5|TRH22_ORYSJ | Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 | 41 | 143 | 1.0E-09 |
sp|Q6P902|TXND2_MOUSE | Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1 | 50 | 144 | 1.0E-09 |
sp|P25372|TRX3_YEAST | Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 | 26 | 154 | 2.0E-09 |
sp|Q8KEA4|THIO1_CHLTE | Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 | 51 | 151 | 2.0E-09 |
sp|Q8LD49|TRXX_ARATH | Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 | 32 | 156 | 2.0E-09 |
sp|P29429|THIO_EMENI | Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 | 50 | 153 | 2.0E-09 |
sp|Q4UNK3|THIO_RICFE | Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 | 66 | 142 | 2.0E-09 |
sp|Q9XI01|PDI11_ARATH | Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 | 61 | 142 | 2.0E-09 |
sp|P34723|THIO_PENCH | Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 | 66 | 145 | 3.0E-09 |
sp|Q92JR5|THIO_RICCN | Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 | 66 | 142 | 4.0E-09 |
sp|Q7X8R5|TRXM2_ORYSJ | Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 | 66 | 156 | 4.0E-09 |
sp|Q9DGI3|THIO_ICTPU | Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 | 50 | 154 | 4.0E-09 |
sp|Q9LKW0|CITRX_SOLLC | Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 | 8 | 129 | 5.0E-09 |
sp|M1A3D5|CITRX_SOLTU | Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 | 34 | 129 | 9.0E-09 |
sp|P42115|THIO_NEUCR | Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 | 64 | 138 | 9.0E-09 |
sp|Q6JE37|CITX2_NICBE | Thioredoxin-like protein CITRX2, chloroplastic OS=Nicotiana benthamiana GN=CITRX2 PE=1 SV=1 | 40 | 129 | 9.0E-09 |
sp|O96952|THIO_GEOCY | Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 | 55 | 155 | 9.0E-09 |
sp|P81109|THIO_CLOSD | Thioredoxin OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=trxA PE=1 SV=2 | 66 | 140 | 1.0E-08 |
sp|P08628|THIO_RABIT | Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 | 55 | 146 | 1.0E-08 |
sp|P29449|TRXH1_TOBAC | Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 | 63 | 153 | 2.0E-08 |
sp|P60226|THIO1_DROYA | Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 | 56 | 156 | 2.0E-08 |
sp|Q9ZEE0|THIO_RICPR | Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 | 66 | 142 | 2.0E-08 |
sp|Q8S091|TRXF_ORYSJ | Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 | 23 | 143 | 3.0E-08 |
sp|Q53LQ0|PDI11_ORYSJ | Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 | 66 | 142 | 3.0E-08 |
sp|P11232|THIO_RAT | Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 | 52 | 146 | 3.0E-08 |
sp|A2YUQ6|CITRX_ORYSI | Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 | 54 | 154 | 3.0E-08 |
sp|Q9SEU7|TRXM3_ARATH | Thioredoxin M3, chloroplastic OS=Arabidopsis thaliana GN=GAT1 PE=2 SV=2 | 66 | 156 | 3.0E-08 |
sp|P08003|PDIA4_MOUSE | Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 | 66 | 139 | 3.0E-08 |
sp|P10639|THIO_MOUSE | Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 | 52 | 146 | 3.0E-08 |
sp|Q9TW67|NGLY1_CAEEL | Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 | 59 | 143 | 3.0E-08 |
sp|P38659|PDIA4_RAT | Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 | 66 | 139 | 3.0E-08 |
sp|Q7XRB5|PDI12_ORYSJ | Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 | 61 | 134 | 3.0E-08 |
sp|A2YIW7|TRXH_ORYSI | Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 | 63 | 143 | 3.0E-08 |
sp|Q0D840|TRXH1_ORYSJ | Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 | 63 | 143 | 3.0E-08 |
sp|Q9FG36|TRL31_ARATH | Thioredoxin-like 3-1, chloroplastic OS=Arabidopsis thaliana GN=WCRKC1 PE=2 SV=3 | 22 | 143 | 4.0E-08 |
sp|Q8H2V6|CITRX_ORYSJ | Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 | 54 | 154 | 4.0E-08 |
sp|Q6JE38|CITX1_NICBE | Thioredoxin-like protein CITRX1, chloroplastic OS=Nicotiana benthamiana GN=CITRX1 PE=2 SV=1 | 13 | 129 | 4.0E-08 |
sp|Q43116|PDI_RICCO | Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 | 61 | 134 | 4.0E-08 |
sp|Q29RV1|PDIA4_BOVIN | Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 | 65 | 139 | 4.0E-08 |
sp|Q9SRG3|PDI12_ARATH | Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 | 51 | 134 | 5.0E-08 |
sp|Q68Y00|THIO_RICTY | Thioredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxA PE=3 SV=1 | 66 | 142 | 5.0E-08 |
sp|Q9SEU8|TRXM2_ARATH | Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 | 33 | 156 | 5.0E-08 |
sp|Q5XHX6|TXND2_RAT | Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2 | 50 | 144 | 6.0E-08 |
sp|Q8TFM8|THIO_FUSCU | Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 | 66 | 138 | 6.0E-08 |
sp|P29451|THIO_MACMU | Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 | 55 | 146 | 6.0E-08 |
sp|P50413|THIO_SHEEP | Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 | 55 | 146 | 7.0E-08 |
sp|Q9XF61|PDI_DATGL | Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 | 61 | 139 | 8.0E-08 |
sp|O48737|TRXM1_ARATH | Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 | 30 | 156 | 9.0E-08 |
sp|Q5UR29|TR548_MIMIV | Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 | 65 | 154 | 9.0E-08 |
sp|Q29RV1|PDIA4_BOVIN | Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 | 66 | 139 | 1.0E-07 |
sp|Q9BDJ3|THIO_CALJA | Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 | 52 | 146 | 1.0E-07 |
sp|P52588|PDI_MAIZE | Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 | 66 | 142 | 1.0E-07 |
sp|O97508|THIO_HORSE | Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 | 55 | 146 | 1.0E-07 |
sp|P47938|THIO1_DROME | Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1 | 56 | 156 | 1.0E-07 |
sp|P10599|THIO_HUMAN | Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 | 55 | 146 | 1.0E-07 |
sp|O97680|THIO_BOVIN | Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 | 55 | 146 | 2.0E-07 |
sp|P29828|PDI_MEDSA | Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 | 66 | 134 | 2.0E-07 |
sp|Q6Z4I3|TRH21_ORYSJ | Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 | 42 | 143 | 2.0E-07 |
sp|P80284|PDI_HORVU | Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 | 62 | 134 | 2.0E-07 |
sp|P82460|THIO_PIG | Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 | 55 | 146 | 2.0E-07 |
sp|O65049|TRXH_PICMA | Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 | 45 | 143 | 3.0E-07 |
sp|Q43636|TRXH_RICCO | Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 | 65 | 143 | 3.0E-07 |
sp|P09857|THIO_ALLVI | Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 | 66 | 154 | 3.0E-07 |
sp|O64394|TRXH_WHEAT | Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 | 61 | 146 | 3.0E-07 |
sp|P09856|TRXF_SPIOL | Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 | 42 | 143 | 3.0E-07 |
sp|Q98TX1|THIO_OPHHA | Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3 | 61 | 146 | 3.0E-07 |
sp|P34329|PDIA4_CAEEL | Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 | 51 | 134 | 3.0E-07 |
sp|P29448|TRXH1_ARATH | Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 | 55 | 143 | 3.0E-07 |
sp|P13667|PDIA4_HUMAN | Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 | 52 | 134 | 4.0E-07 |
sp|Q10057|PDI1_SCHPO | Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 | 43 | 148 | 4.0E-07 |
sp|Q96419|TRXH_FAGES | Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 | 63 | 152 | 5.0E-07 |
sp|Q9M7X9|CITRX_ARATH | Thioredoxin-like protein CITRX, chloroplastic OS=Arabidopsis thaliana GN=CITRX PE=1 SV=1 | 40 | 129 | 5.0E-07 |
sp|Q92249|ERP38_NEUCR | Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 | 50 | 134 | 8.0E-07 |
sp|P80028|TRXH_CHLRE | Thioredoxin H-type OS=Chlamydomonas reinhardtii GN=TRXH PE=1 SV=3 | 60 | 143 | 8.0E-07 |
sp|Q39241|TRXH5_ARATH | Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 | 64 | 143 | 9.0E-07 |
sp|P52589|PDI_WHEAT | Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 | 66 | 134 | 1.0E-06 |
sp|Q5R9M3|THIO_PONAB | Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 | 55 | 146 | 1.0E-06 |
sp|Q9XIF4|TRXH7_ARATH | Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 | 37 | 152 | 1.0E-06 |
sp|P21610|THIO_EUBAC | Thioredoxin OS=Eubacterium acidaminophilum GN=trxA PE=1 SV=2 | 42 | 137 | 1.0E-06 |
sp|Q42403|TRXH3_ARATH | Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 | 63 | 146 | 2.0E-06 |
sp|P29450|TRXF_PEA | Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 | 47 | 143 | 2.0E-06 |
sp|O64432|TRXH_BRACM | Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 | 56 | 146 | 2.0E-06 |
sp|Q54KN7|THIO5_DICDI | Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 | 65 | 143 | 2.0E-06 |
sp|Q86H62|GLRX3_DICDI | Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 | 51 | 145 | 2.0E-06 |
sp|P68176|TRXH_BRAOL | Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 | 56 | 146 | 2.0E-06 |
sp|P68177|TRXH1_BRANA | Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 | 56 | 146 | 2.0E-06 |
sp|P96132|THIO_THIRO | Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 | 66 | 91 | 2.0E-06 |
sp|Q69AB2|TXND8_MOUSE | Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 | 50 | 140 | 2.0E-06 |
sp|Q86VQ3|TXND2_HUMAN | Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 | 52 | 146 | 2.0E-06 |
sp|P08003|PDIA4_MOUSE | Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 | 65 | 134 | 3.0E-06 |
sp|P38659|PDIA4_RAT | Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 | 65 | 134 | 3.0E-06 |
sp|Q942L2|PDI22_ORYSJ | Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 | 62 | 134 | 3.0E-06 |
sp|P38661|PDIA6_MEDSA | Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 | 52 | 143 | 3.0E-06 |
sp|Q9USR1|TXL1_SCHPO | Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 | 68 | 146 | 3.0E-06 |
sp|P13667|PDIA4_HUMAN | Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 | 66 | 139 | 4.0E-06 |
sp|P21609|THIO_CLOLI | Thioredoxin OS=Clostridium litorale GN=trxA PE=1 SV=2 | 66 | 151 | 4.0E-06 |
sp|Q9LXZ8|TRH10_ARATH | Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 | 34 | 143 | 4.0E-06 |
sp|Q54EN4|PDI2_DICDI | Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 | 61 | 136 | 4.0E-06 |
sp|Q86IA3|PDI1_DICDI | Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 | 57 | 135 | 4.0E-06 |
sp|P12865|BS2_TRYBB | Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 | 61 | 143 | 5.0E-06 |
sp|Q3T0L2|ERP44_BOVIN | Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 | 50 | 134 | 5.0E-06 |
sp|Q8VX13|PDI13_ARATH | Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 | 63 | 142 | 5.0E-06 |
sp|Q1ZXE0|THIO4_DICDI | Putative thioredoxin-4 OS=Dictyostelium discoideum GN=trxD PE=3 SV=2 | 66 | 156 | 5.0E-06 |
sp|Q8VWG7|TDX_ARATH | TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 | 63 | 143 | 5.0E-06 |
sp|Q9D1Q6|ERP44_MOUSE | Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 | 42 | 134 | 9.0E-06 |
sp|P73263|THIO2_SYNY3 | Thioredoxin-like protein slr1139 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1139 PE=1 SV=1 | 60 | 144 | 9.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 18 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|054560 MTFFLRGSTTTFRTLRASTTRSIRNSPTVSLSHRSFHSSLRISAIYSNANTETVEKVIKESQNRVVLVDFYADWC QPCRLFSPILEKVASEPNTSANGLPVDLVKVDTESEQGQQLAIKHQISSLPTVYVYKDGEAVTHFVGALPEPHLK QVLDRL* |
Coding | >AgabiH97|054560 ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC ACAGAGACCGTCGAGAAAGTCATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGACTGGTGT CAACCATGTCGCCTATTCTCTCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCC GTTGACCTCGTTAAAGTAGATACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGATCAGTTCCTTG CCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAAG CAAGTGTTGGACCGTTTGTAA |
Transcript | >AgabiH97|054560 ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC ACAGAGACCGTCGAGAAAGTCATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGACTGGTGT CAACCATGTCGCCTATTCTCTCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCC GTTGACCTCGTTAAAGTAGATACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGATCAGTTCCTTG CCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAAG CAAGTGTTGGACCGTTTGTAA |
Gene | >AgabiH97|054560 ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC ACAGAGGTCCGTCGTCCCTATGTCAACTGTATCACGCGCTCATCAAATTCAATATACTTAGACCGTCGAGAAAGT CATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGAGTCAGTTGAGAGAAAGTGTACCTTTAT TCCCCCGCATAACTCATGATCATCCCCAATTGGATTGAAACACAACAGCTGGTGTCAACCATGTCGCCTATTCTC TCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCCGTTGACCTCGTTAAAGTAGA TACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGGCGAGTGTATTTTCATCTTCAATAACACAATT TTTTCTCATGTAACAAACGCACTTTCGGCAAAATGGCTACGCGACAATCATTCATGCGTTTCAGATCAGTTCCTT GCCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAA GCAAGTGTTGGACCGTTTGTAA |