Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054560
Gene name
Locationscaffold_3:504212..504909
Strand+
Gene length (bp)697
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.5E-20 51 154
PF13098 Thioredoxin_2 Thioredoxin-like domain 2.2E-07 60 153
PF13728 TraF F plasmid transfer operon protein 3.3E-05 42 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 62 155 1.0E-17
sp|Q8CPL5|THIO_STAES Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 62 155 2.0E-17
sp|Q5HQ29|THIO_STAEQ Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 62 155 2.0E-17
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 48 154 4.0E-17
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 48 154 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 62 155 1.0E-17
sp|Q8CPL5|THIO_STAES Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1 62 155 2.0E-17
sp|Q5HQ29|THIO_STAEQ Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1 62 155 2.0E-17
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 48 154 4.0E-17
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 48 154 4.0E-17
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 48 154 4.0E-17
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 48 154 4.0E-17
sp|Q49WR2|THIO_STAS1 Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 62 155 7.0E-17
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 62 155 1.0E-16
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 62 155 1.0E-16
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 62 155 1.0E-16
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 62 155 1.0E-16
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 50 156 2.0E-16
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 61 153 3.0E-16
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 61 143 1.0E-15
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 61 143 1.0E-15
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 61 143 1.0E-15
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 46 156 1.0E-15
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 46 156 1.0E-15
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 61 155 1.0E-15
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 66 155 2.0E-15
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 66 155 3.0E-15
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 66 155 3.0E-15
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 60 155 3.0E-15
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 66 155 5.0E-15
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 66 155 5.0E-15
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 60 154 5.0E-15
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 60 149 7.0E-15
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 63 145 1.0E-14
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 66 155 1.0E-14
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 34 156 2.0E-14
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 53 155 2.0E-14
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 16 155 3.0E-14
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 64 155 3.0E-14
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 61 143 5.0E-14
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 63 154 7.0E-14
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 63 154 7.0E-14
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 63 154 7.0E-14
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 63 154 7.0E-14
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 63 154 7.0E-14
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 63 154 7.0E-14
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 61 153 7.0E-14
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 61 155 7.0E-14
sp|Q05739|THIO_STRC2 Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 42 149 8.0E-14
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 66 149 9.0E-14
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 65 155 1.0E-13
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 61 153 1.0E-13
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 61 149 1.0E-13
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 63 156 2.0E-13
sp|P0A4L3|THIO_LISMO Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 59 155 3.0E-13
sp|P0A4L4|THIO_LISIN Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 59 155 3.0E-13
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 63 142 3.0E-13
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 62 156 4.0E-13
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 62 156 5.0E-13
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 2 154 5.0E-13
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 66 156 5.0E-13
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 62 146 6.0E-13
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 66 142 7.0E-13
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 33 143 7.0E-13
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 63 154 8.0E-13
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 66 155 1.0E-12
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 65 142 1.0E-12
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 61 155 1.0E-12
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 63 155 1.0E-12
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 42 155 2.0E-12
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 40 143 2.0E-12
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 66 155 3.0E-12
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 47 154 3.0E-12
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 66 155 3.0E-12
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 21 155 4.0E-12
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 66 155 4.0E-12
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 66 155 5.0E-12
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 63 153 1.0E-11
sp|P29447|THIO3_DICDI Thioredoxin-3 OS=Dictyostelium discoideum GN=trxC PE=3 SV=2 55 143 1.0E-11
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 62 145 1.0E-11
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 65 142 2.0E-11
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 55 155 2.0E-11
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 66 155 2.0E-11
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 57 154 2.0E-11
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 66 142 2.0E-11
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 45 143 2.0E-11
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 66 156 2.0E-11
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 63 156 2.0E-11
sp|P75512|THIO_MYCPN Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 61 155 2.0E-11
sp|P57653|THIO_BUCAI Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 67 155 3.0E-11
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 65 142 4.0E-11
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 68 149 6.0E-11
sp|P08058|THIO_RHOSH Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 66 149 7.0E-11
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 66 155 1.0E-10
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 60 143 1.0E-10
sp|P77395|YBBN_ECOLI Uncharacterized protein YbbN OS=Escherichia coli (strain K12) GN=ybbN PE=1 SV=2 48 156 2.0E-10
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 66 154 2.0E-10
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 58 143 2.0E-10
sp|P29445|THIO1_DICDI Thioredoxin-1 OS=Dictyostelium discoideum GN=trxA PE=1 SV=1 53 143 3.0E-10
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 30 156 3.0E-10
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 59 146 3.0E-10
sp|Q7XKD0|TRXX_ORYSJ Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 66 156 4.0E-10
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 63 146 4.0E-10
sp|P29446|THIO2_DICDI Thioredoxin-2 (Fragment) OS=Dictyostelium discoideum GN=trxB PE=2 SV=1 55 140 5.0E-10
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 55 156 5.0E-10
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 58 152 5.0E-10
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 52 143 6.0E-10
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 66 155 6.0E-10
sp|Q7XQQ2|TRXM3_ORYSJ Thioredoxin M3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0430800 PE=2 SV=4 66 146 6.0E-10
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 61 149 9.0E-10
sp|P08629|THIO_CHICK Thioredoxin OS=Gallus gallus GN=TXN PE=3 SV=2 45 146 9.0E-10
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 41 143 1.0E-09
sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus GN=Txndc2 PE=1 SV=1 50 144 1.0E-09
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 26 154 2.0E-09
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 51 151 2.0E-09
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 32 156 2.0E-09
sp|P29429|THIO_EMENI Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=TRX1 PE=1 SV=2 50 153 2.0E-09
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 66 142 2.0E-09
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 61 142 2.0E-09
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 66 145 3.0E-09
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 66 142 4.0E-09
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 66 156 4.0E-09
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 50 154 4.0E-09
sp|Q9LKW0|CITRX_SOLLC Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 8 129 5.0E-09
sp|M1A3D5|CITRX_SOLTU Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 34 129 9.0E-09
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 64 138 9.0E-09
sp|Q6JE37|CITX2_NICBE Thioredoxin-like protein CITRX2, chloroplastic OS=Nicotiana benthamiana GN=CITRX2 PE=1 SV=1 40 129 9.0E-09
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 55 155 9.0E-09
sp|P81109|THIO_CLOSD Thioredoxin OS=Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654) GN=trxA PE=1 SV=2 66 140 1.0E-08
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 55 146 1.0E-08
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 63 153 2.0E-08
sp|P60226|THIO1_DROYA Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 56 156 2.0E-08
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 66 142 2.0E-08
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 23 143 3.0E-08
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 66 142 3.0E-08
sp|P11232|THIO_RAT Thioredoxin OS=Rattus norvegicus GN=Txn PE=1 SV=2 52 146 3.0E-08
sp|A2YUQ6|CITRX_ORYSI Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 54 154 3.0E-08
sp|Q9SEU7|TRXM3_ARATH Thioredoxin M3, chloroplastic OS=Arabidopsis thaliana GN=GAT1 PE=2 SV=2 66 156 3.0E-08
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 66 139 3.0E-08
sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus GN=Txn PE=1 SV=3 52 146 3.0E-08
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 59 143 3.0E-08
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 66 139 3.0E-08
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 61 134 3.0E-08
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 63 143 3.0E-08
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 63 143 3.0E-08
sp|Q9FG36|TRL31_ARATH Thioredoxin-like 3-1, chloroplastic OS=Arabidopsis thaliana GN=WCRKC1 PE=2 SV=3 22 143 4.0E-08
sp|Q8H2V6|CITRX_ORYSJ Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 54 154 4.0E-08
sp|Q6JE38|CITX1_NICBE Thioredoxin-like protein CITRX1, chloroplastic OS=Nicotiana benthamiana GN=CITRX1 PE=2 SV=1 13 129 4.0E-08
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 61 134 4.0E-08
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 65 139 4.0E-08
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 51 134 5.0E-08
sp|Q68Y00|THIO_RICTY Thioredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxA PE=3 SV=1 66 142 5.0E-08
sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 33 156 5.0E-08
sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2 50 144 6.0E-08
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 66 138 6.0E-08
sp|P29451|THIO_MACMU Thioredoxin OS=Macaca mulatta GN=TXN PE=3 SV=2 55 146 6.0E-08
sp|P50413|THIO_SHEEP Thioredoxin OS=Ovis aries GN=TXN PE=3 SV=2 55 146 7.0E-08
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 61 139 8.0E-08
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 30 156 9.0E-08
sp|Q5UR29|TR548_MIMIV Thioredoxin-like protein R548 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R548 PE=3 SV=1 65 154 9.0E-08
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 66 139 1.0E-07
sp|Q9BDJ3|THIO_CALJA Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3 52 146 1.0E-07
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 66 142 1.0E-07
sp|O97508|THIO_HORSE Thioredoxin OS=Equus caballus GN=TXN PE=3 SV=3 55 146 1.0E-07
sp|P47938|THIO1_DROME Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1 56 156 1.0E-07
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 55 146 1.0E-07
sp|O97680|THIO_BOVIN Thioredoxin OS=Bos taurus GN=TXN PE=3 SV=3 55 146 2.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 66 134 2.0E-07
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 42 143 2.0E-07
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 62 134 2.0E-07
sp|P82460|THIO_PIG Thioredoxin OS=Sus scrofa GN=TXN PE=1 SV=3 55 146 2.0E-07
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 45 143 3.0E-07
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 65 143 3.0E-07
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 66 154 3.0E-07
sp|O64394|TRXH_WHEAT Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 61 146 3.0E-07
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 42 143 3.0E-07
sp|Q98TX1|THIO_OPHHA Thioredoxin OS=Ophiophagus hannah GN=TXN PE=3 SV=3 61 146 3.0E-07
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 51 134 3.0E-07
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 55 143 3.0E-07
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 52 134 4.0E-07
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 43 148 4.0E-07
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 63 152 5.0E-07
sp|Q9M7X9|CITRX_ARATH Thioredoxin-like protein CITRX, chloroplastic OS=Arabidopsis thaliana GN=CITRX PE=1 SV=1 40 129 5.0E-07
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 50 134 8.0E-07
sp|P80028|TRXH_CHLRE Thioredoxin H-type OS=Chlamydomonas reinhardtii GN=TRXH PE=1 SV=3 60 143 8.0E-07
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 64 143 9.0E-07
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 66 134 1.0E-06
sp|Q5R9M3|THIO_PONAB Thioredoxin OS=Pongo abelii GN=TXN PE=3 SV=3 55 146 1.0E-06
sp|Q9XIF4|TRXH7_ARATH Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 37 152 1.0E-06
sp|P21610|THIO_EUBAC Thioredoxin OS=Eubacterium acidaminophilum GN=trxA PE=1 SV=2 42 137 1.0E-06
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 63 146 2.0E-06
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 47 143 2.0E-06
sp|O64432|TRXH_BRACM Thioredoxin H-type OS=Brassica campestris GN=PEC-2 PE=2 SV=1 56 146 2.0E-06
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 65 143 2.0E-06
sp|Q86H62|GLRX3_DICDI Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 51 145 2.0E-06
sp|P68176|TRXH_BRAOL Thioredoxin H-type OS=Brassica oleracea GN=BOPC17 PE=2 SV=1 56 146 2.0E-06
sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 OS=Brassica napus GN=THL-1 PE=2 SV=1 56 146 2.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 66 91 2.0E-06
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 50 140 2.0E-06
sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 52 146 2.0E-06
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 65 134 3.0E-06
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 65 134 3.0E-06
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 62 134 3.0E-06
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 52 143 3.0E-06
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 68 146 3.0E-06
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 66 139 4.0E-06
sp|P21609|THIO_CLOLI Thioredoxin OS=Clostridium litorale GN=trxA PE=1 SV=2 66 151 4.0E-06
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 34 143 4.0E-06
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 61 136 4.0E-06
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 57 135 4.0E-06
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 61 143 5.0E-06
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 50 134 5.0E-06
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 63 142 5.0E-06
sp|Q1ZXE0|THIO4_DICDI Putative thioredoxin-4 OS=Dictyostelium discoideum GN=trxD PE=3 SV=2 66 156 5.0E-06
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 63 143 5.0E-06
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 42 134 9.0E-06
sp|P73263|THIO2_SYNY3 Thioredoxin-like protein slr1139 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1139 PE=1 SV=1 60 144 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054560
MTFFLRGSTTTFRTLRASTTRSIRNSPTVSLSHRSFHSSLRISAIYSNANTETVEKVIKESQNRVVLVDFYADWC
QPCRLFSPILEKVASEPNTSANGLPVDLVKVDTESEQGQQLAIKHQISSLPTVYVYKDGEAVTHFVGALPEPHLK
QVLDRL*
Coding >AgabiH97|054560
ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC
TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC
ACAGAGACCGTCGAGAAAGTCATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGACTGGTGT
CAACCATGTCGCCTATTCTCTCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCC
GTTGACCTCGTTAAAGTAGATACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGATCAGTTCCTTG
CCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAAG
CAAGTGTTGGACCGTTTGTAA
Transcript >AgabiH97|054560
ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC
TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC
ACAGAGACCGTCGAGAAAGTCATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGACTGGTGT
CAACCATGTCGCCTATTCTCTCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCC
GTTGACCTCGTTAAAGTAGATACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGATCAGTTCCTTG
CCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAAG
CAAGTGTTGGACCGTTTGTAA
Gene >AgabiH97|054560
ATGACATTTTTCCTCCGAGGTAGCACTACTACTTTCAGAACGCTCAGAGCTTCAACAACCCGATCTATCCGAAAC
TCACCGACAGTCTCACTCTCACATCGGTCCTTCCATTCTTCACTCCGTATTTCCGCCATCTACTCCAACGCCAAC
ACAGAGGTCCGTCGTCCCTATGTCAACTGTATCACGCGCTCATCAAATTCAATATACTTAGACCGTCGAGAAAGT
CATCAAAGAATCTCAAAACCGTGTCGTCTTGGTCGATTTCTACGCCGAGTCAGTTGAGAGAAAGTGTACCTTTAT
TCCCCCGCATAACTCATGATCATCCCCAATTGGATTGAAACACAACAGCTGGTGTCAACCATGTCGCCTATTCTC
TCCCATCCTTGAAAAAGTCGCTTCTGAACCCAACACCTCCGCCAACGGTCTCCCCGTTGACCTCGTTAAAGTAGA
TACCGAATCCGAACAAGGTCAACAACTGGCCATTAAACACCAGGCGAGTGTATTTTCATCTTCAATAACACAATT
TTTTCTCATGTAACAAACGCACTTTCGGCAAAATGGCTACGCGACAATCATTCATGCGTTTCAGATCAGTTCCTT
GCCTACAGTATACGTGTACAAGGATGGGGAGGCTGTGACGCATTTTGTGGGAGCATTGCCTGAACCCCATCTCAA
GCAAGTGTTGGACCGTTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail