© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|054510 |
| Gene name | |
| Location | scaffold_3:492107..495944 |
| Strand | - |
| Gene length (bp) | 3837 |
| Transcript length (bp) | 2826 |
| Coding sequence length (bp) | 2826 |
| Protein length (aa) | 942 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF02773 | S-AdoMet_synt_C | S-adenosylmethionine synthetase, C-terminal domain | 4.3E-59 | 250 | 374 |
| PF02772 | S-AdoMet_synt_M | S-adenosylmethionine synthetase, central domain | 9.8E-47 | 128 | 248 |
| PF00438 | S-AdoMet_synt_N | S-adenosylmethionine synthetase, N-terminal domain | 5.5E-44 | 17 | 114 |
| PF13522 | GATase_6 | Glutamine amidotransferase domain | 9.3E-12 | 469 | 614 |
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 3.3E-09 | 678 | 801 |
| PF13537 | GATase_7 | Glutamine amidotransferase domain | 4.5E-09 | 486 | 615 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P48466|METK_NEUCR | S-adenosylmethionine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eth-1 PE=2 SV=1 | 1 | 373 | 0.0E+00 |
| sp|O60198|METK_SCHPO | S-adenosylmethionine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sam1 PE=3 SV=1 | 17 | 374 | 0.0E+00 |
| sp|P41390|PUR1_SCHPO | Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 | 401 | 895 | 0.0E+00 |
| sp|P04046|PUR1_YEAST | Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 | 401 | 888 | 0.0E+00 |
| sp|Q12698|PUR1_LACKL | Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 | 401 | 891 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P48466|METK_NEUCR | S-adenosylmethionine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eth-1 PE=2 SV=1 | 1 | 373 | 0.0E+00 |
| sp|O60198|METK_SCHPO | S-adenosylmethionine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sam1 PE=3 SV=1 | 17 | 374 | 0.0E+00 |
| sp|P41390|PUR1_SCHPO | Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 | 401 | 895 | 0.0E+00 |
| sp|P04046|PUR1_YEAST | Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 | 401 | 888 | 0.0E+00 |
| sp|Q12698|PUR1_LACKL | Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 | 401 | 891 | 0.0E+00 |
| sp|P19358|METK2_YEAST | S-adenosylmethionine synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM2 PE=1 SV=3 | 17 | 374 | 0.0E+00 |
| sp|P10659|METK1_YEAST | S-adenosylmethionine synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM1 PE=1 SV=2 | 15 | 374 | 0.0E+00 |
| sp|Q51342|PUR1_PSEAE | Amidophosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purF PE=3 SV=3 | 401 | 895 | 0.0E+00 |
| sp|Q9L6B8|PUR1_PASMU | Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 | 401 | 904 | 0.0E+00 |
| sp|P43854|PUR1_HAEIN | Amidophosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purF PE=3 SV=2 | 401 | 895 | 0.0E+00 |
| sp|Q2KJC6|METK1_BOVIN | S-adenosylmethionine synthase isoform type-1 OS=Bos taurus GN=MAT1A PE=2 SV=1 | 4 | 373 | 1.0E-179 |
| sp|Q00266|METK1_HUMAN | S-adenosylmethionine synthase isoform type-1 OS=Homo sapiens GN=MAT1A PE=1 SV=2 | 11 | 373 | 1.0E-179 |
| sp|Q3THS6|METK2_MOUSE | S-adenosylmethionine synthase isoform type-2 OS=Mus musculus GN=Mat2a PE=1 SV=2 | 10 | 374 | 2.0E-179 |
| sp|Q5R5H1|METK2_PONAB | S-adenosylmethionine synthase isoform type-2 OS=Pongo abelii GN=MAT2A PE=2 SV=1 | 10 | 374 | 5.0E-179 |
| sp|Q4R924|METK2_MACFA | S-adenosylmethionine synthase isoform type-2 OS=Macaca fascicularis GN=MAT2A PE=2 SV=1 | 10 | 374 | 5.0E-179 |
| sp|P31153|METK2_HUMAN | S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens GN=MAT2A PE=1 SV=1 | 10 | 374 | 5.0E-179 |
| sp|P13444|METK1_RAT | S-adenosylmethionine synthase isoform type-1 OS=Rattus norvegicus GN=Mat1a PE=1 SV=2 | 4 | 373 | 3.0E-178 |
| sp|P18298|METK2_RAT | S-adenosylmethionine synthase isoform type-2 OS=Rattus norvegicus GN=Mat2a PE=1 SV=1 | 10 | 374 | 3.0E-178 |
| sp|Q91X83|METK1_MOUSE | S-adenosylmethionine synthase isoform type-1 OS=Mus musculus GN=Mat1a PE=1 SV=1 | 4 | 373 | 3.0E-177 |
| sp|P0AG17|PUR1_SHIFL | Amidophosphoribosyltransferase OS=Shigella flexneri GN=purF PE=3 SV=2 | 401 | 891 | 2.0E-175 |
| sp|P0AG16|PUR1_ECOLI | Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) GN=purF PE=1 SV=2 | 401 | 891 | 2.0E-175 |
| sp|P50304|METK_ASCIM | S-adenosylmethionine synthase OS=Ascobolus immersus PE=3 SV=1 | 15 | 373 | 2.0E-174 |
| sp|Q54F07|METK_DICDI | S-adenosylmethionine synthase OS=Dictyostelium discoideum GN=metK PE=1 SV=1 | 17 | 374 | 1.0E-170 |
| sp|P50306|METK4_CAEEL | Probable S-adenosylmethionine synthase 4 OS=Caenorhabditis elegans GN=sams-4 PE=1 SV=1 | 14 | 373 | 2.0E-165 |
| sp|P50305|METK3_CAEEL | Probable S-adenosylmethionine synthase 3 OS=Caenorhabditis elegans GN=sams-3 PE=1 SV=1 | 17 | 373 | 4.0E-165 |
| sp|Q27522|METK5_CAEEL | Probable S-adenosylmethionine synthase 5 OS=Caenorhabditis elegans GN=sams-5 PE=3 SV=2 | 12 | 373 | 3.0E-163 |
| sp|Q95032|METK_ACACA | S-adenosylmethionine synthase OS=Acanthamoeba castellanii GN=metK PE=2 SV=1 | 17 | 373 | 2.0E-162 |
| sp|Q6SYB9|METK2_TOBAC | S-adenosylmethionine synthase 2 OS=Nicotiana tabacum GN=SAMS2 PE=2 SV=1 | 17 | 374 | 6.0E-161 |
| sp|P40320|METK_DROME | S-adenosylmethionine synthase OS=Drosophila melanogaster GN=Sam-S PE=2 SV=2 | 17 | 374 | 4.0E-157 |
| sp|O17680|METK1_CAEEL | Probable S-adenosylmethionine synthase 1 OS=Caenorhabditis elegans GN=sams-1 PE=1 SV=1 | 17 | 373 | 1.0E-156 |
| sp|A8HYU5|METK_CHLRE | S-adenosylmethionine synthase OS=Chlamydomonas reinhardtii GN=METM PE=3 SV=1 | 17 | 374 | 4.0E-153 |
| sp|Q6F3F0|METK3_ATRNU | S-adenosylmethionine synthase 3 OS=Atriplex nummularia GN=SAMS3 PE=1 SV=1 | 17 | 374 | 7.0E-153 |
| sp|Q7XZR1|METK1_ATRNU | S-adenosylmethionine synthase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2 | 17 | 374 | 1.0E-152 |
| sp|Q0DKY4|METK1_ORYSJ | S-adenosylmethionine synthase 1 OS=Oryza sativa subsp. japonica GN=SAM1 PE=2 SV=1 | 17 | 374 | 1.0E-152 |
| sp|A2Y053|METK1_ORYSI | S-adenosylmethionine synthase 1 OS=Oryza sativa subsp. indica GN=SAM1 PE=2 SV=2 | 17 | 374 | 1.0E-152 |
| sp|Q6F3F1|METK4_ATRNU | S-adenosylmethionine synthase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1 | 17 | 374 | 1.0E-152 |
| sp|A9PHC5|METK4_POPTR | S-adenosylmethionine synthase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1 | 17 | 374 | 2.0E-152 |
| sp|B0LXM0|METK_WHEAT | S-adenosylmethionine synthase OS=Triticum aestivum GN=SAMS PE=2 SV=1 | 17 | 374 | 6.0E-152 |
| sp|A7QJG1|METK3_VITVI | S-adenosylmethionine synthase 3 OS=Vitis vinifera GN=METK3 PE=3 SV=1 | 17 | 374 | 6.0E-152 |
| sp|Q4LB23|METK2_HORVU | S-adenosylmethionine synthase 2 OS=Hordeum vulgare GN=SAM2 PE=2 SV=1 | 17 | 374 | 6.0E-152 |
| sp|Q6F3F3|METK2_ATRNU | S-adenosylmethionine synthase 2 OS=Atriplex nummularia GN=SAMS2 PE=1 SV=1 | 17 | 374 | 7.0E-152 |
| sp|Q96552|METK2_CATRO | S-adenosylmethionine synthase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1 | 17 | 374 | 8.0E-152 |
| sp|Q96551|METK1_CATRO | S-adenosylmethionine synthase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1 | 17 | 374 | 9.0E-152 |
| sp|A9PDZ7|METK2_POPTR | S-adenosylmethionine synthase 2 OS=Populus trichocarpa GN=METK2 PE=2 SV=2 | 17 | 374 | 1.0E-151 |
| sp|A7PQS0|METK1_VITVI | S-adenosylmethionine synthase 1 OS=Vitis vinifera GN=METK1 PE=3 SV=1 | 17 | 374 | 1.0E-151 |
| sp|A9NUH8|METK1_PICSI | S-adenosylmethionine synthase 1 OS=Picea sitchensis GN=METK1 PE=2 SV=1 | 17 | 374 | 1.0E-151 |
| sp|Q96553|METK3_CATRO | S-adenosylmethionine synthase 3 OS=Catharanthus roseus GN=SAMS3 PE=1 SV=1 | 17 | 374 | 1.0E-151 |
| sp|Q944U4|METK_DENCR | S-adenosylmethionine synthase OS=Dendrobium crumenatum GN=SAMS PE=2 SV=1 | 17 | 374 | 2.0E-151 |
| sp|P50299|METK1_HORVU | S-adenosylmethionine synthase 1 OS=Hordeum vulgare GN=SAM1 PE=2 SV=1 | 17 | 374 | 3.0E-151 |
| sp|Q4LB21|METK4_HORVU | S-adenosylmethionine synthase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1 | 17 | 374 | 3.0E-151 |
| sp|P50302|METK2_ACTCH | S-adenosylmethionine synthase 2 OS=Actinidia chinensis GN=SAM2 PE=2 SV=1 | 17 | 374 | 3.0E-151 |
| sp|P93254|METK_MESCR | S-adenosylmethionine synthase OS=Mesembryanthemum crystallinum GN=METK PE=2 SV=1 | 17 | 374 | 3.0E-151 |
| sp|O22338|METK_MUSAC | S-adenosylmethionine synthase OS=Musa acuminata GN=METK PE=2 SV=1 | 17 | 374 | 4.0E-151 |
| sp|Q9LGU6|METK3_ORYSJ | S-adenosylmethionine synthase 3 OS=Oryza sativa subsp. japonica GN=METK3 PE=2 SV=1 | 17 | 374 | 4.0E-151 |
| sp|A6XMY9|METK1_TRIMO | S-adenosylmethionine synthase 1 OS=Triticum monococcum GN=SAMS1 PE=2 SV=1 | 17 | 374 | 5.0E-151 |
| sp|Q9LUT2|METK4_ARATH | S-adenosylmethionine synthase 4 OS=Arabidopsis thaliana GN=METK4 PE=1 SV=1 | 17 | 374 | 5.0E-151 |
| sp|A7NVX9|METK2_VITVI | S-adenosylmethionine synthase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1 | 17 | 374 | 1.0E-150 |
| sp|A7Q0V4|METK5_VITVI | S-adenosylmethionine synthase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1 | 17 | 374 | 1.0E-150 |
| sp|Q9FUZ1|METK2_BRAJU | S-adenosylmethionine synthase 2 OS=Brassica juncea GN=MSAMS2 PE=2 SV=1 | 17 | 374 | 2.0E-150 |
| sp|A9PEK8|METK3_POPTR | S-adenosylmethionine synthase 3 OS=Populus trichocarpa GN=METK3 PE=2 SV=1 | 17 | 374 | 2.0E-150 |
| sp|P50301|METK1_ACTCH | S-adenosylmethionine synthase 1 OS=Actinidia chinensis GN=SAM1 PE=2 SV=1 | 17 | 374 | 2.0E-150 |
| sp|O43938|METK_LEIIN | S-adenosylmethionine synthase OS=Leishmania infantum GN=METK PE=2 SV=2 | 17 | 376 | 3.0E-150 |
| sp|Q8GTL5|METK_CARPA | S-adenosylmethionine synthase OS=Carica papaya GN=SAMS PE=2 SV=1 | 17 | 374 | 4.0E-150 |
| sp|Q307Y9|METK1_SOLTU | S-adenosylmethionine synthase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1 | 17 | 374 | 4.0E-150 |
| sp|Q4H1G4|METK1_BETVU | S-adenosylmethionine synthase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1 | 17 | 374 | 4.0E-150 |
| sp|P43281|METK2_SOLLC | S-adenosylmethionine synthase 2 OS=Solanum lycopersicum GN=SAM2 PE=2 SV=1 | 17 | 374 | 4.0E-150 |
| sp|Q9SBQ7|METK3_PETHY | S-adenosylmethionine synthase 3 OS=Petunia hybrida GN=SAM3 PE=2 SV=1 | 17 | 374 | 5.0E-150 |
| sp|Q9FPL6|METK2_SUASA | S-adenosylmethionine synthase 2 OS=Suaeda salsa GN=METK2 PE=2 SV=1 | 17 | 374 | 7.0E-150 |
| sp|A9P822|METK1_POPTR | S-adenosylmethionine synthase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1 | 17 | 374 | 7.0E-150 |
| sp|Q9AT56|METK1_ELAUM | S-adenosylmethionine synthase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1 | 17 | 373 | 1.0E-149 |
| sp|Q8W3Y4|METK_PHALU | S-adenosylmethionine synthase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1 | 17 | 374 | 1.0E-149 |
| sp|A7L2Z6|METK_GOSHI | S-adenosylmethionine synthase OS=Gossypium hirsutum GN=SAMS PE=2 SV=1 | 17 | 374 | 1.0E-149 |
| sp|A4PU48|METK_MEDTR | S-adenosylmethionine synthase OS=Medicago truncatula GN=METK PE=3 SV=1 | 17 | 374 | 1.0E-149 |
| sp|A9NYY0|METK2_PICSI | S-adenosylmethionine synthase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1 | 17 | 374 | 3.0E-149 |
| sp|A9PHE9|METK5_POPTR | S-adenosylmethionine synthase 5 OS=Populus trichocarpa GN=METK5 PE=2 SV=1 | 17 | 374 | 3.0E-149 |
| sp|Q94FA5|METK4_BRAJU | S-adenosylmethionine synthase 4 OS=Brassica juncea GN=MSAMS4 PE=2 SV=1 | 17 | 374 | 3.0E-149 |
| sp|P43280|METK1_SOLLC | S-adenosylmethionine synthase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1 | 17 | 374 | 3.0E-149 |
| sp|P47916|METK_POPDE | S-adenosylmethionine synthase OS=Populus deltoides GN=METK PE=2 SV=1 | 17 | 374 | 4.0E-149 |
| sp|Q9AT55|METK2_ELAUM | S-adenosylmethionine synthase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1 | 17 | 374 | 4.0E-149 |
| sp|P93438|METK2_ORYSJ | S-adenosylmethionine synthase 2 OS=Oryza sativa subsp. japonica GN=SAM2 PE=2 SV=1 | 17 | 374 | 5.0E-149 |
| sp|P43282|METK3_SOLLC | S-adenosylmethionine synthase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1 | 17 | 374 | 6.0E-149 |
| sp|Q9SJL8|METK3_ARATH | S-adenosylmethionine synthase 3 OS=Arabidopsis thaliana GN=METK3 PE=1 SV=1 | 17 | 374 | 8.0E-149 |
| sp|Q4LB22|METK3_HORVU | S-adenosylmethionine synthase 3 OS=Hordeum vulgare GN=SAM3 PE=2 SV=1 | 17 | 374 | 1.0E-148 |
| sp|Q4H1G3|METK2_BETVU | S-adenosylmethionine synthase 2 OS=Beta vulgaris GN=SAMS2 PE=2 SV=1 | 17 | 374 | 1.0E-148 |
| sp|P48498|METK1_PETHY | S-adenosylmethionine synthase 1 OS=Petunia hybrida GN=SAM1 PE=2 SV=1 | 17 | 374 | 1.0E-148 |
| sp|Q38JH8|METK2_SOLTU | S-adenosylmethionine synthase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1 | 17 | 374 | 1.0E-148 |
| sp|Q837P9|METK_ENTFA | S-adenosylmethionine synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metK PE=3 SV=1 | 12 | 374 | 2.0E-148 |
| sp|A4ULF8|METK_MEDSF | S-adenosylmethionine synthase OS=Medicago sativa subsp. falcata GN=SAMS PE=2 SV=1 | 17 | 374 | 2.0E-148 |
| sp|Q9SBQ5|METK2_PETHY | S-adenosylmethionine synthase 2 OS=Petunia hybrida GN=SAM2 PE=2 SV=1 | 17 | 374 | 3.0E-148 |
| sp|Q9M7K8|METK1_TOBAC | S-adenosylmethionine synthase 1 OS=Nicotiana tabacum GN=SAMS1 PE=2 SV=1 | 17 | 374 | 5.0E-148 |
| sp|Q56TU4|METK1_DAUCA | S-adenosylmethionine synthase 1 OS=Daucus carota GN=SAMS1 PE=2 SV=1 | 17 | 374 | 5.0E-148 |
| sp|P24260|METK2_DIACA | S-adenosylmethionine synthase 2 OS=Dianthus caryophyllus GN=SAM2 PE=2 SV=1 | 17 | 374 | 5.0E-148 |
| sp|Q6GV10|METK_SOLPL | S-adenosylmethionine synthase OS=Solanum palustre GN=SAMS PE=2 SV=1 | 17 | 374 | 5.0E-148 |
| sp|A7PRJ6|METK4_VITVI | S-adenosylmethionine synthase 4 OS=Vitis vinifera GN=METK4 PE=3 SV=1 | 17 | 374 | 5.0E-148 |
| sp|Q84MM2|METK_LITCN | S-adenosylmethionine synthase OS=Litchi chinensis GN=SAMS PE=2 SV=1 | 17 | 374 | 8.0E-148 |
| sp|Q5KW02|METK_GEOKA | S-adenosylmethionine synthase OS=Geobacillus kaustophilus (strain HTA426) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-147 |
| sp|Q65FV8|METK_BACLD | S-adenosylmethionine synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metK PE=3 SV=1 | 12 | 374 | 2.0E-147 |
| sp|A4IRZ1|METK_GEOTN | S-adenosylmethionine synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-147 |
| sp|Q3AFS4|METK_CARHZ | S-adenosylmethionine synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-147 |
| sp|Q9FVG7|METK2_PINCO | S-adenosylmethionine synthase 2 OS=Pinus contorta GN=SAMS2 PE=2 SV=1 | 17 | 374 | 6.0E-147 |
| sp|Q9LDQ7|METK_CAMSI | S-adenosylmethionine synthase OS=Camellia sinensis GN=SAM PE=2 SV=1 | 17 | 374 | 7.0E-147 |
| sp|Q5DNB1|METK_BRARP | S-adenosylmethionine synthase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1 | 17 | 374 | 8.0E-147 |
| sp|Q94FA4|METK5_BRAJU | S-adenosylmethionine synthase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1 | 17 | 374 | 8.0E-147 |
| sp|P23686|METK1_ARATH | S-adenosylmethionine synthase 1 OS=Arabidopsis thaliana GN=SAM1 PE=1 SV=2 | 17 | 374 | 1.0E-146 |
| sp|Q56TU3|METK2_DAUCA | S-adenosylmethionine synthase 2 OS=Daucus carota GN=SAMS2 PE=2 SV=1 | 17 | 374 | 2.0E-146 |
| sp|P49611|METK1_BRAJU | S-adenosylmethionine synthase 1 OS=Brassica juncea GN=SAMS1 PE=2 SV=1 | 17 | 374 | 2.0E-146 |
| sp|Q38YF8|METK_LACSS | S-adenosylmethionine synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-146 |
| sp|P49613|METK2_PEA | S-adenosylmethionine synthase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1 | 17 | 366 | 6.0E-146 |
| sp|C5D6E9|METK_GEOSW | S-adenosylmethionine synthase OS=Geobacillus sp. (strain WCH70) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-146 |
| sp|A7GU40|METK_BACCN | S-adenosylmethionine synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=metK PE=3 SV=1 | 12 | 374 | 1.0E-145 |
| sp|P17562|METK2_ARATH | S-adenosylmethionine synthase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1 | 17 | 374 | 1.0E-145 |
| sp|A4XHT8|METK_CALS8 | S-adenosylmethionine synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-145 |
| sp|A9P2P4|METK3_PICSI | S-adenosylmethionine synthase 3 OS=Picea sitchensis GN=METK3 PE=2 SV=1 | 17 | 374 | 1.0E-145 |
| sp|Q94FA6|METK3_BRAJU | S-adenosylmethionine synthase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1 | 17 | 374 | 6.0E-145 |
| sp|Q5WDZ8|METK_BACSK | S-adenosylmethionine synthase OS=Bacillus clausii (strain KSM-K16) GN=metK PE=3 SV=1 | 15 | 374 | 3.0E-144 |
| sp|A9KL72|METK_CLOPH | S-adenosylmethionine synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-144 |
| sp|A8FGH7|METK_BACP2 | S-adenosylmethionine synthase OS=Bacillus pumilus (strain SAFR-032) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-144 |
| sp|Q816Q8|METK_BACCR | S-adenosylmethionine synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metK PE=3 SV=1 | 12 | 374 | 4.0E-144 |
| sp|B7H9C7|METK_BACC4 | S-adenosylmethionine synthase OS=Bacillus cereus (strain B4264) GN=metK PE=3 SV=1 | 12 | 374 | 4.0E-144 |
| sp|C1EW36|METK_BACC3 | S-adenosylmethionine synthase OS=Bacillus cereus (strain 03BB102) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|A0RJZ7|METK_BACAH | S-adenosylmethionine synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|Q632S5|METK_BACCZ | S-adenosylmethionine synthase OS=Bacillus cereus (strain ZK / E33L) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|B9J265|METK_BACCQ | S-adenosylmethionine synthase OS=Bacillus cereus (strain Q1) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|B7JT32|METK_BACC0 | S-adenosylmethionine synthase OS=Bacillus cereus (strain AH820) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|Q81KI0|METK_BACAN | S-adenosylmethionine synthase OS=Bacillus anthracis GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|C3LAZ9|METK_BACAC | S-adenosylmethionine synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|C3PCC4|METK_BACAA | S-adenosylmethionine synthase OS=Bacillus anthracis (strain A0248) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|P54419|METK_BACSU | S-adenosylmethionine synthase OS=Bacillus subtilis (strain 168) GN=metK PE=3 SV=2 | 12 | 374 | 5.0E-144 |
| sp|Q6HCB4|METK_BACHK | S-adenosylmethionine synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|B7HSV6|METK_BACC7 | S-adenosylmethionine synthase OS=Bacillus cereus (strain AH187) GN=metK PE=3 SV=1 | 12 | 374 | 5.0E-144 |
| sp|Q72YV6|METK_BACC1 | S-adenosylmethionine synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metK PE=3 SV=1 | 12 | 374 | 6.0E-144 |
| sp|Q9K7Q9|METK_BACHD | S-adenosylmethionine synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-144 |
| sp|B7IL28|METK_BACC2 | S-adenosylmethionine synthase OS=Bacillus cereus (strain G9842) GN=metK PE=3 SV=1 | 12 | 374 | 8.0E-144 |
| sp|Q00VB2|METK_OSTTA | S-adenosylmethionine synthase OS=Ostreococcus tauri GN=METK PE=3 SV=1 | 17 | 374 | 1.0E-143 |
| sp|B9MQ10|METK_CALBD | S-adenosylmethionine synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-143 |
| sp|A7Z7Y9|METK_BACMF | S-adenosylmethionine synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=metK PE=3 SV=1 | 12 | 374 | 3.0E-143 |
| sp|Q18CL7|METK_PEPD6 | S-adenosylmethionine synthase OS=Peptoclostridium difficile (strain 630) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-143 |
| sp|Q8NVZ9|METK_STAAW | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MW2) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|A8Z4L2|METK_STAAT | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|Q6G8E3|METK_STAAS | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MSSA476) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|A6QHX0|METK_STAAE | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Newman) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|Q5HEY9|METK_STAAC | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain COL) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|Q2YTK1|METK_STAAB | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metK PE=3 SV=2 | 18 | 374 | 9.0E-143 |
| sp|Q2G1W4|METK_STAA8 | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|Q2FFV6|METK_STAA3 | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain USA300) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-143 |
| sp|A3DHM4|METK_CLOTH | S-adenosylmethionine synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-142 |
| sp|A9VLC6|METK_BACWK | S-adenosylmethionine synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=metK PE=3 SV=1 | 12 | 374 | 1.0E-142 |
| sp|Q02WN8|METK_LACLS | S-adenosylmethionine synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-142 |
| sp|Q9CEE0|METK_LACLA | S-adenosylmethionine synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-142 |
| sp|P50300|METK_PINBN | S-adenosylmethionine synthase OS=Pinus banksiana GN=METK PE=2 SV=1 | 17 | 366 | 3.0E-142 |
| sp|Q0SR05|METK_CLOPS | S-adenosylmethionine synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|Q0TND4|METK_CLOP1 | S-adenosylmethionine synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|P66767|METK_STAAN | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain N315) GN=metK PE=1 SV=1 | 18 | 374 | 4.0E-142 |
| sp|P66766|METK_STAAM | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|A5ITV6|METK_STAA9 | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain JH9) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|A6U2Q1|METK_STAA2 | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain JH1) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|A7X3N2|METK_STAA1 | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|Q6GFR6|METK_STAAR | S-adenosylmethionine synthase OS=Staphylococcus aureus (strain MRSA252) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-142 |
| sp|A2RN40|METK_LACLM | S-adenosylmethionine synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-142 |
| sp|P50307|METK_STAAU | S-adenosylmethionine synthase OS=Staphylococcus aureus GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-142 |
| sp|C1FQQ5|METK_CLOBJ | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-142 |
| sp|B0KC73|METK_THEP3 | S-adenosylmethionine synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-142 |
| sp|A5HY62|METK_CLOBH | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-141 |
| sp|A7FQI8|METK_CLOB1 | S-adenosylmethionine synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-141 |
| sp|A7G9S1|METK_CLOBL | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-141 |
| sp|B1KST9|METK_CLOBM | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-141 |
| sp|B2G8G3|METK_LACRJ | S-adenosylmethionine synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-141 |
| sp|A5VL29|METK_LACRD | S-adenosylmethionine synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-141 |
| sp|B1IE45|METK_CLOBK | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-141 |
| sp|A8YWU7|METK_LACH4 | S-adenosylmethionine synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-141 |
| sp|A4S779|METK_OSTLU | S-adenosylmethionine synthase OS=Ostreococcus lucimarinus (strain CCE9901) GN=METK-1 PE=3 SV=1 | 17 | 374 | 2.0E-140 |
| sp|Q67T90|METK_SYMTH | S-adenosylmethionine synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metK PE=3 SV=1 | 15 | 374 | 2.0E-140 |
| sp|Q49YL6|METK_STAS1 | S-adenosylmethionine synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metK PE=3 SV=1 | 12 | 374 | 2.0E-140 |
| sp|Q8EP05|METK_OCEIH | S-adenosylmethionine synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-140 |
| sp|Q1LS34|METK_CUPMC | S-adenosylmethionine synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-140 |
| sp|B8I4C1|METK_CLOCE | S-adenosylmethionine synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-140 |
| sp|A8MJT0|METK_ALKOO | S-adenosylmethionine synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-139 |
| sp|Q5FIN8|METK_LACAC | S-adenosylmethionine synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-138 |
| sp|Q3A388|METK_PELCD | S-adenosylmethionine synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-138 |
| sp|Q03QA4|METK_LACBA | S-adenosylmethionine synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-138 |
| sp|C6E2L2|METK_GEOSM | S-adenosylmethionine synthase OS=Geobacter sp. (strain M21) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-138 |
| sp|Q39W48|METK_GEOMG | S-adenosylmethionine synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-138 |
| sp|Q88XB8|METK_LACPL | S-adenosylmethionine synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-138 |
| sp|A5GA66|METK_GEOUR | S-adenosylmethionine synthase OS=Geobacter uraniireducens (strain Rf4) GN=metK PE=3 SV=1 | 17 | 374 | 4.0E-138 |
| sp|Q6AQ43|METK_DESPS | S-adenosylmethionine synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-138 |
| sp|Q4L7C7|METK_STAHJ | S-adenosylmethionine synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metK PE=3 SV=1 | 12 | 374 | 7.0E-138 |
| sp|A8AWW6|METK_STRGC | S-adenosylmethionine synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-138 |
| sp|A3CNY4|METK_STRSV | S-adenosylmethionine synthase OS=Streptococcus sanguinis (strain SK36) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-137 |
| sp|Q0KF39|METK_CUPNH | S-adenosylmethionine synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-137 |
| sp|Q486L6|METK_COLP3 | S-adenosylmethionine synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=metK PE=3 SV=1 | 16 | 374 | 2.0E-137 |
| sp|B4RWC7|METK_ALTMD | S-adenosylmethionine synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-137 |
| sp|A7NFR6|METK_ROSCS | S-adenosylmethionine synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=metK PE=3 SV=1 | 17 | 374 | 2.0E-137 |
| sp|A4J945|METK_DESRM | S-adenosylmethionine synthase OS=Desulfotomaculum reducens (strain MI-1) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-137 |
| sp|Q8DT23|METK_STRMU | S-adenosylmethionine synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-137 |
| sp|Q3SFY2|METK_THIDA | S-adenosylmethionine synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-137 |
| sp|Q2RK28|METK_MOOTA | S-adenosylmethionine synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=metK PE=3 SV=1 | 18 | 369 | 1.0E-136 |
| sp|B9DN19|METK_STACT | S-adenosylmethionine synthase OS=Staphylococcus carnosus (strain TM300) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-136 |
| sp|B2GDG2|METK_LACF3 | S-adenosylmethionine synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-136 |
| sp|B8FSB9|METK_DESHD | S-adenosylmethionine synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-136 |
| sp|B2UZL0|METK_CLOBA | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-136 |
| sp|A5UQL0|METK_ROSS1 | S-adenosylmethionine synthase OS=Roseiflexus sp. (strain RS-1) GN=metK PE=3 SV=1 | 17 | 374 | 2.0E-136 |
| sp|B2TK10|METK_CLOBB | S-adenosylmethionine synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-136 |
| sp|Q476V0|METK_CUPPJ | S-adenosylmethionine synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-136 |
| sp|Q5ZTY6|METK_LEGPH | S-adenosylmethionine synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-136 |
| sp|B9K7H2|METK_THENN | S-adenosylmethionine synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-136 |
| sp|A5IDK5|METK_LEGPC | S-adenosylmethionine synthase OS=Legionella pneumophila (strain Corby) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-136 |
| sp|Q5X3N0|METK_LEGPA | S-adenosylmethionine synthase OS=Legionella pneumophila (strain Paris) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-136 |
| sp|Q8RCE4|METK_CALS4 | S-adenosylmethionine synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-136 |
| sp|P61946|METK_GEOSL | S-adenosylmethionine synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-136 |
| sp|A2C0F4|METK_PROM1 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain NATL1A) GN=metK PE=3 SV=1 | 16 | 365 | 6.0E-136 |
| sp|Q15QK1|METK_PSEA6 | S-adenosylmethionine synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-136 |
| sp|Q5WV18|METK_LEGPL | S-adenosylmethionine synthase OS=Legionella pneumophila (strain Lens) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-136 |
| sp|Q8CNT5|METK_STAES | S-adenosylmethionine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metK PE=3 SV=1 | 12 | 374 | 7.0E-136 |
| sp|Q5HNB8|METK_STAEQ | S-adenosylmethionine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metK PE=3 SV=1 | 12 | 374 | 7.0E-136 |
| sp|A4VWU8|METK_STRSY | S-adenosylmethionine synthase OS=Streptococcus suis (strain 05ZYH33) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-136 |
| sp|A4W351|METK_STRS2 | S-adenosylmethionine synthase OS=Streptococcus suis (strain 98HAH33) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-136 |
| sp|A5CYJ7|METK_PELTS | S-adenosylmethionine synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=metK PE=3 SV=1 | 18 | 373 | 8.0E-136 |
| sp|A9IH21|METK_BORPD | S-adenosylmethionine synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-135 |
| sp|Q5LZI0|METK_STRT1 | S-adenosylmethionine synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=metK PE=3 SV=2 | 18 | 374 | 2.0E-135 |
| sp|Q898W7|METK_CLOTE | S-adenosylmethionine synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-135 |
| sp|Q5M434|METK_STRT2 | S-adenosylmethionine synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=metK PE=3 SV=2 | 18 | 374 | 2.0E-135 |
| sp|Q7VUL5|METK_BORPE | S-adenosylmethionine synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-135 |
| sp|Q7W200|METK_BORPA | S-adenosylmethionine synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metK PE=3 SV=2 | 17 | 374 | 3.0E-135 |
| sp|Q7WQX8|METK_BORBR | S-adenosylmethionine synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metK PE=3 SV=2 | 17 | 374 | 3.0E-135 |
| sp|B9LBJ9|METK_CHLSY | S-adenosylmethionine synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-135 |
| sp|A9WGQ3|METK_CHLAA | S-adenosylmethionine synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-135 |
| sp|Q92AZ5|METK_LISIN | S-adenosylmethionine synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-135 |
| sp|B4F1A5|METK_PROMH | S-adenosylmethionine synthase OS=Proteus mirabilis (strain HI4320) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-135 |
| sp|A1JPS4|METK_YERE8 | S-adenosylmethionine synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-135 |
| sp|Q46H57|METK_PROMT | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain NATL2A) GN=metK PE=3 SV=1 | 16 | 365 | 7.0E-135 |
| sp|Q1QCH2|METK_PSYCK | S-adenosylmethionine synthase OS=Psychrobacter cryohalolentis (strain K5) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-135 |
| sp|Q4FTH7|METK_PSYA2 | S-adenosylmethionine synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-135 |
| sp|B1LB17|METK_THESQ | S-adenosylmethionine synthase OS=Thermotoga sp. (strain RQ2) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-135 |
| sp|A5ILS4|METK_THEP1 | S-adenosylmethionine synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-135 |
| sp|Q9X1Y8|METK_THEMA | S-adenosylmethionine synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-135 |
| sp|B3WCC9|METK_LACCB | S-adenosylmethionine synthase OS=Lactobacillus casei (strain BL23) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-135 |
| sp|Q03AU4|METK_LACC3 | S-adenosylmethionine synthase OS=Lactobacillus casei (strain ATCC 334) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-135 |
| sp|Q7N119|METK_PHOLL | S-adenosylmethionine synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metK PE=3 SV=1 | 17 | 374 | 9.0E-135 |
| sp|Q5QVM7|METK_IDILO | S-adenosylmethionine synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|B8DFQ7|METK_LISMH | S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|Q71Z03|METK_LISMF | S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|C1KVW3|METK_LISMC | S-adenosylmethionine synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|Q8Y6M0|METK_LISMO | S-adenosylmethionine synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|Q0AXL1|METK_SYNWW | S-adenosylmethionine synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-134 |
| sp|C1C6A5|METK_STRP7 | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain 70585) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-134 |
| sp|A0AJB9|METK_LISW6 | S-adenosylmethionine synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-134 |
| sp|C0M9M7|METK_STRE4 | S-adenosylmethionine synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|Q9I5Z0|METK_PSEAE | S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|Q02TL9|METK_PSEAB | S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|B7V4D3|METK_PSEA8 | S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|A6UZ09|METK_PSEA7 | S-adenosylmethionine synthase OS=Pseudomonas aeruginosa (strain PA7) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|Q7V2Y8|METK_PROMP | S-adenosylmethionine synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=metK PE=3 SV=1 | 17 | 365 | 4.0E-134 |
| sp|C0MCM1|METK_STRS7 | S-adenosylmethionine synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-134 |
| sp|B4U228|METK_STREM | S-adenosylmethionine synthase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-134 |
| sp|Q8E5Y0|METK_STRA3 | S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-134 |
| sp|B9DSM6|METK_STRU0 | S-adenosylmethionine synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-134 |
| sp|C1CQM2|METK_STRZT | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-134 |
| sp|Q97RN9|METK_STRPN | S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-134 |
| sp|Q8E0A3|METK_STRA5 | S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-134 |
| sp|Q3K1M7|METK_STRA1 | S-adenosylmethionine synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-134 |
| sp|Q3IDQ1|METK_PSEHT | S-adenosylmethionine synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-134 |
| sp|Q8DQH0|METK_STRR6 | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-133 |
| sp|B2INE5|METK_STRPS | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-133 |
| sp|B1IAT8|METK_STRPI | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-133 |
| sp|B5E364|METK_STRP4 | S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-133 |
| sp|Q04LE0|METK_STRP2 | S-adenosylmethionine synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-133 |
| sp|Q63YH5|METK_BURPS | S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain K96243) GN=metK PE=1 SV=1 | 17 | 374 | 1.0E-133 |
| sp|A3N4I1|METK_BURP6 | S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 668) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|Q3JX94|METK_BURP1 | S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 1710b) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|A3NQ73|METK_BURP0 | S-adenosylmethionine synthase OS=Burkholderia pseudomallei (strain 1106a) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|A1V7L5|METK_BURMS | S-adenosylmethionine synthase OS=Burkholderia mallei (strain SAVP1) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|Q62EZ1|METK_BURMA | S-adenosylmethionine synthase OS=Burkholderia mallei (strain ATCC 23344) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|A2S860|METK_BURM9 | S-adenosylmethionine synthase OS=Burkholderia mallei (strain NCTC 10229) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|A3MRQ4|METK_BURM7 | S-adenosylmethionine synthase OS=Burkholderia mallei (strain NCTC 10247) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|Q47JN4|METK_DECAR | S-adenosylmethionine synthase OS=Dechloromonas aromatica (strain RCB) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-133 |
| sp|B8ZNB7|METK_STRPJ | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-133 |
| sp|C3K3F5|METK_PSEFS | S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain SBW25) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-133 |
| sp|Q2T267|METK_BURTA | S-adenosylmethionine synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-133 |
| sp|Q6MPK2|METK_BDEBA | S-adenosylmethionine synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-133 |
| sp|C1CJL0|METK_STRZP | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain P1031) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-133 |
| sp|A8GIX9|METK_SERP5 | S-adenosylmethionine synthase OS=Serratia proteamaculans (strain 568) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-133 |
| sp|Q1R0L1|METK_CHRSD | S-adenosylmethionine synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-133 |
| sp|C1CDB0|METK_STRZJ | S-adenosylmethionine synthase OS=Streptococcus pneumoniae (strain JJA) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-133 |
| sp|Q48CH3|METK_PSE14 | S-adenosylmethionine synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-133 |
| sp|A0Q2Y4|METK_CLONN | S-adenosylmethionine synthase OS=Clostridium novyi (strain NT) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-132 |
| sp|B2VF06|METK_ERWT9 | S-adenosylmethionine synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-132 |
| sp|Q8Y347|METK_RALSO | S-adenosylmethionine synthase OS=Ralstonia solanacearum (strain GMI1000) GN=metK PE=3 SV=1 | 17 | 374 | 2.0E-132 |
| sp|A7MJQ6|METK_CROS8 | S-adenosylmethionine synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-132 |
| sp|Q4ZM01|METK_PSEU2 | S-adenosylmethionine synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-132 |
| sp|Q0BAY8|METK_BURCM | S-adenosylmethionine synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-132 |
| sp|B1YPQ4|METK_BURA4 | S-adenosylmethionine synthase OS=Burkholderia ambifaria (strain MC40-6) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-132 |
| sp|Q6FAQ6|METK_ACIAD | S-adenosylmethionine synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-132 |
| sp|Q3J7R5|METK_NITOC | S-adenosylmethionine synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metK PE=3 SV=1 | 19 | 374 | 3.0E-132 |
| sp|Q087Q9|METK_SHEFN | S-adenosylmethionine synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-132 |
| sp|Q88AK7|METK_PSESM | S-adenosylmethionine synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-132 |
| sp|Q74KS4|METK_LACJO | S-adenosylmethionine synthase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-132 |
| sp|B5RE50|METK_SALG2 | S-adenosylmethionine synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-132 |
| sp|Q60CG7|METK_METCA | S-adenosylmethionine synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-132 |
| sp|B2UD22|METK_RALPJ | S-adenosylmethionine synthase OS=Ralstonia pickettii (strain 12J) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-132 |
| sp|Q97F85|METK_CLOAB | S-adenosylmethionine synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-132 |
| sp|B1J2Z8|METK_PSEPW | S-adenosylmethionine synthase OS=Pseudomonas putida (strain W619) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-131 |
| sp|A8FRL1|METK_SHESH | S-adenosylmethionine synthase OS=Shewanella sediminis (strain HAW-EB3) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-131 |
| sp|A4JIQ4|METK_BURVG | S-adenosylmethionine synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-131 |
| sp|Q48SU7|METK_STRPM | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-131 |
| sp|Q1I3X6|METK_PSEE4 | S-adenosylmethionine synthase OS=Pseudomonas entomophila (strain L48) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-131 |
| sp|A1KS98|METK_NEIMF | S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=metK PE=3 SV=1 | 16 | 374 | 2.0E-131 |
| sp|A5WDU0|METK_PSYWF | S-adenosylmethionine synthase OS=Psychrobacter sp. (strain PRwf-1) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-131 |
| sp|A8APG1|METK_CITK8 | S-adenosylmethionine synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-131 |
| sp|C0QXK7|METK_BRAHW | S-adenosylmethionine synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=metK PE=3 SV=1 | 16 | 374 | 3.0E-131 |
| sp|B8J8T3|METK_ANAD2 | S-adenosylmethionine synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-131 |
| sp|Q31WK4|METK_SHIBS | S-adenosylmethionine synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-131 |
| sp|B2U0W2|METK_SHIB3 | S-adenosylmethionine synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-131 |
| sp|B4E800|METK_BURCJ | S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-131 |
| sp|A8G2X2|METK_PROM2 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=metK PE=3 SV=1 | 17 | 382 | 3.0E-131 |
| sp|Q39BZ1|METK_BURL3 | S-adenosylmethionine synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-131 |
| sp|Q12QA6|METK_SHEDO | S-adenosylmethionine synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|A2BUU2|METK_PROM5 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=metK PE=3 SV=1 | 17 | 374 | 4.0E-131 |
| sp|Q2NRD1|METK_SODGM | S-adenosylmethionine synthase OS=Sodalis glossinidius (strain morsitans) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|P66764|METK_SALTY | S-adenosylmethionine synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metK PE=3 SV=2 | 18 | 374 | 4.0E-131 |
| sp|P66765|METK_SALTI | S-adenosylmethionine synthase OS=Salmonella typhi GN=metK PE=3 SV=2 | 18 | 374 | 4.0E-131 |
| sp|B4TV58|METK_SALSV | S-adenosylmethionine synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|B5BFP7|METK_SALPK | S-adenosylmethionine synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|Q5PJJ2|METK_SALPA | S-adenosylmethionine synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|B4T5J6|METK_SALNS | S-adenosylmethionine synthase OS=Salmonella newport (strain SL254) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|B5QY66|METK_SALEP | S-adenosylmethionine synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|Q57K26|METK_SALCH | S-adenosylmethionine synthase OS=Salmonella choleraesuis (strain SC-B67) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|A9MRD1|METK_SALAR | S-adenosylmethionine synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-131 |
| sp|Q1J626|METK_STRPF | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-131 |
| sp|P0DF55|METK_STRPQ | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-131 |
| sp|P0DF54|METK_STRP3 | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-131 |
| sp|B5FUK0|METK_SALDC | S-adenosylmethionine synthase OS=Salmonella dublin (strain CT_02021853) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-131 |
| sp|B5XM14|METK_STRPZ | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|A2RE06|METK_STRPG | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|Q1JL80|METK_STRPC | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|Q1JB36|METK_STRPB | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|Q8P0G6|METK_STRP8 | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|C1DKE3|METK_AZOVD | S-adenosylmethionine synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|B7LPQ9|METK_ESCF3 | S-adenosylmethionine synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-131 |
| sp|B8CU43|METK_SHEPW | S-adenosylmethionine synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-131 |
| sp|A0KBF2|METK_BURCH | S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain HI2424) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-131 |
| sp|B1K0F2|METK_BURCC | S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-131 |
| sp|Q1BSN9|METK_BURCA | S-adenosylmethionine synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-131 |
| sp|Q88D60|METK_PSEPK | S-adenosylmethionine synthase OS=Pseudomonas putida (strain KT2440) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-131 |
| sp|B0KLZ1|METK_PSEPG | S-adenosylmethionine synthase OS=Pseudomonas putida (strain GB-1) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-131 |
| sp|A5WA00|METK_PSEP1 | S-adenosylmethionine synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-131 |
| sp|A6W3D6|METK_MARMS | S-adenosylmethionine synthase OS=Marinomonas sp. (strain MWYL1) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-131 |
| sp|B2JJY6|METK_BURP8 | S-adenosylmethionine synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metK PE=3 SV=1 | 17 | 374 | 8.0E-131 |
| sp|Q3YXS9|METK_SHISS | S-adenosylmethionine synthase OS=Shigella sonnei (strain Ss046) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|P0A820|METK_SHIFL | S-adenosylmethionine synthase OS=Shigella flexneri GN=metK PE=3 SV=2 | 18 | 374 | 8.0E-131 |
| sp|Q0T0V0|METK_SHIF8 | S-adenosylmethionine synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|Q32C11|METK_SHIDS | S-adenosylmethionine synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B1LDF1|METK_ECOSM | S-adenosylmethionine synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B6I780|METK_ECOSE | S-adenosylmethionine synthase OS=Escherichia coli (strain SE11) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B7N7J5|METK_ECOLU | S-adenosylmethionine synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|P0A817|METK_ECOLI | S-adenosylmethionine synthase OS=Escherichia coli (strain K12) GN=metK PE=1 SV=2 | 18 | 374 | 8.0E-131 |
| sp|B1IT65|METK_ECOLC | S-adenosylmethionine synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|P0A818|METK_ECOL6 | S-adenosylmethionine synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metK PE=3 SV=2 | 18 | 374 | 8.0E-131 |
| sp|Q0TDR0|METK_ECOL5 | S-adenosylmethionine synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|A8A481|METK_ECOHS | S-adenosylmethionine synthase OS=Escherichia coli O9:H4 (strain HS) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B1XFA4|METK_ECODH | S-adenosylmethionine synthase OS=Escherichia coli (strain K12 / DH10B) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|C5A0L1|METK_ECOBW | S-adenosylmethionine synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B7LYX2|METK_ECO8A | S-adenosylmethionine synthase OS=Escherichia coli O8 (strain IAI1) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B7NI05|METK_ECO7I | S-adenosylmethionine synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B5YQD9|METK_ECO5E | S-adenosylmethionine synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|P0A819|METK_ECO57 | S-adenosylmethionine synthase OS=Escherichia coli O157:H7 GN=metK PE=3 SV=2 | 18 | 374 | 8.0E-131 |
| sp|B7LFK4|METK_ECO55 | S-adenosylmethionine synthase OS=Escherichia coli (strain 55989 / EAEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B7UHY9|METK_ECO27 | S-adenosylmethionine synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|A7ZR64|METK_ECO24 | S-adenosylmethionine synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|B5F5L4|METK_SALA4 | S-adenosylmethionine synthase OS=Salmonella agona (strain SL483) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-131 |
| sp|Q8EIB4|METK_SHEON | S-adenosylmethionine synthase OS=Shewanella oneidensis (strain MR-1) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-131 |
| sp|Q5XBJ6|METK_STRP6 | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=metK PE=3 SV=1 | 18 | 374 | 9.0E-131 |
| sp|B4ULF7|METK_ANASK | S-adenosylmethionine synthase OS=Anaeromyxobacter sp. (strain K) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-130 |
| sp|B4THH4|METK_SALHS | S-adenosylmethionine synthase OS=Salmonella heidelberg (strain SL476) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|A4XPF8|METK_PSEMY | S-adenosylmethionine synthase OS=Pseudomonas mendocina (strain ymp) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|A9M1V8|METK_NEIM0 | S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=metK PE=3 SV=1 | 16 | 374 | 1.0E-130 |
| sp|A1RN71|METK_SHESW | S-adenosylmethionine synthase OS=Shewanella sp. (strain W3-18-1) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|Q0HRM1|METK_SHESR | S-adenosylmethionine synthase OS=Shewanella sp. (strain MR-7) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|Q0HM65|METK_SHESM | S-adenosylmethionine synthase OS=Shewanella sp. (strain MR-4) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|A0L0K9|METK_SHESA | S-adenosylmethionine synthase OS=Shewanella sp. (strain ANA-3) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|A1SZJ9|METK_PSYIN | S-adenosylmethionine synthase OS=Psychromonas ingrahamii (strain 37) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-130 |
| sp|A4Y3R7|METK_SHEPC | S-adenosylmethionine synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|Q4K4I7|METK_PSEF5 | S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|Q9RWM6|METK_DEIRA | S-adenosylmethionine synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|A6TDV1|METK_KLEP7 | S-adenosylmethionine synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|Q1H4X2|METK_METFK | S-adenosylmethionine synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=metK PE=3 SV=1 | 16 | 374 | 2.0E-130 |
| sp|Q3K5E8|METK_PSEPF | S-adenosylmethionine synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|A3QAX5|METK_SHELP | S-adenosylmethionine synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-130 |
| sp|Q99Z77|METK_STRP1 | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M1 GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|B1JNQ2|METK_YERPY | S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|Q666P5|METK_YERPS | S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|A4TI83|METK_YERPP | S-adenosylmethionine synthase OS=Yersinia pestis (strain Pestoides F) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|Q1CEX6|METK_YERPN | S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|A9R314|METK_YERPG | S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|Q8ZHG7|METK_YERPE | S-adenosylmethionine synthase OS=Yersinia pestis GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|B2K0S7|METK_YERPB | S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|Q1CB69|METK_YERPA | S-adenosylmethionine synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|A7FEZ7|METK_YERP3 | S-adenosylmethionine synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-130 |
| sp|A4WE78|METK_ENT38 | S-adenosylmethionine synthase OS=Enterobacter sp. (strain 638) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-130 |
| sp|Q5GW76|METK_XANOR | S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-130 |
| sp|B2SPP5|METK_XANOP | S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-130 |
| sp|Q2NZF1|METK_XANOM | S-adenosylmethionine synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-130 |
| sp|Q3BXB7|METK_XANC5 | S-adenosylmethionine synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-130 |
| sp|Q8PP75|METK_XANAC | S-adenosylmethionine synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metK PE=3 SV=1 | 17 | 374 | 6.0E-130 |
| sp|B5XUA8|METK_KLEP3 | S-adenosylmethionine synthase OS=Klebsiella pneumoniae (strain 342) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-130 |
| sp|Q9JY09|METK_NEIMB | S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metK PE=3 SV=1 | 16 | 374 | 7.0E-130 |
| sp|Q7VDM7|METK_PROMA | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=metK PE=3 SV=1 | 17 | 365 | 7.0E-130 |
| sp|A4VRE8|METK_PSEU5 | S-adenosylmethionine synthase OS=Pseudomonas stutzeri (strain A1501) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-130 |
| sp|Q2IM98|METK_ANADE | S-adenosylmethionine synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=metK PE=3 SV=1 | 17 | 374 | 9.0E-130 |
| sp|Q9JVV6|METK_NEIMA | S-adenosylmethionine synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metK PE=3 SV=1 | 16 | 374 | 1.0E-129 |
| sp|A2BPB2|METK_PROMS | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain AS9601) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-129 |
| sp|Q7WYG5|METK_LEGJE | S-adenosylmethionine synthase OS=Legionella jeonii GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-129 |
| sp|B1Y6S3|METK_LEPCP | S-adenosylmethionine synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-129 |
| sp|A3PB34|METK_PROM0 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=metK PE=3 SV=1 | 17 | 365 | 1.0E-129 |
| sp|B1I6C4|METK_DESAP | S-adenosylmethionine synthase OS=Desulforudis audaxviator (strain MP104C) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-129 |
| sp|A4G977|METK_HERAR | S-adenosylmethionine synthase OS=Herminiimonas arsenicoxydans GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-129 |
| sp|A8H0M7|METK_SHEPA | S-adenosylmethionine synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=metK PE=3 SV=1 | 18 | 374 | 2.0E-129 |
| sp|A9L1M6|METK_SHEB9 | S-adenosylmethionine synthase OS=Shewanella baltica (strain OS195) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|A6WS79|METK_SHEB8 | S-adenosylmethionine synthase OS=Shewanella baltica (strain OS185) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|B8E5U7|METK_SHEB2 | S-adenosylmethionine synthase OS=Shewanella baltica (strain OS223) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|Q03GG8|METK_PEDPA | S-adenosylmethionine synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|B0RV66|METK_XANCB | S-adenosylmethionine synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-129 |
| sp|Q4UR08|METK_XANC8 | S-adenosylmethionine synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-129 |
| sp|B2FPC7|METK_STRMK | S-adenosylmethionine synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-129 |
| sp|Q1JGA1|METK_STRPD | S-adenosylmethionine synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|A3D0T8|METK_SHEB5 | S-adenosylmethionine synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-129 |
| sp|A1S9A6|METK_SHEAM | S-adenosylmethionine synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-129 |
| sp|Q0A6D3|METK_ALKEH | S-adenosylmethionine synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metK PE=3 SV=1 | 17 | 374 | 4.0E-129 |
| sp|Q2Y5Z1|METK_NITMU | S-adenosylmethionine synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-129 |
| sp|B4SK03|METK_STRM5 | S-adenosylmethionine synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-129 |
| sp|A6T2Z1|METK_JANMA | S-adenosylmethionine synthase OS=Janthinobacterium sp. (strain Marseille) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-129 |
| sp|B0S2I6|METK_FINM2 | S-adenosylmethionine synthase OS=Finegoldia magna (strain ATCC 29328) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-129 |
| sp|B1KF18|METK_SHEWM | S-adenosylmethionine synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-129 |
| sp|Q5FAC0|METK_NEIG1 | S-adenosylmethionine synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metK PE=3 SV=2 | 16 | 374 | 7.0E-129 |
| sp|C1DCT7|METK_LARHH | S-adenosylmethionine synthase OS=Laribacter hongkongensis (strain HLHK9) GN=metK PE=3 SV=1 | 17 | 374 | 8.0E-129 |
| sp|A9BDW6|METK_PROM4 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=metK PE=3 SV=1 | 16 | 365 | 9.0E-129 |
| sp|Q7NZF9|METK_CHRVO | S-adenosylmethionine synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metK PE=3 SV=1 | 16 | 374 | 1.0E-128 |
| sp|A5CRX0|METK_CLAM3 | S-adenosylmethionine synthase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-128 |
| sp|B4RQ36|METK_NEIG2 | S-adenosylmethionine synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=metK PE=3 SV=1 | 16 | 374 | 1.0E-128 |
| sp|Q8PCH3|METK_XANCP | S-adenosylmethionine synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-128 |
| sp|Q0VL83|METK_ALCBS | S-adenosylmethionine synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-128 |
| sp|Q3ZZN7|METK_DEHMC | S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-128 |
| sp|Q31CL7|METK_PROM9 | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=metK PE=3 SV=1 | 17 | 365 | 1.0E-128 |
| sp|Q31EL0|METK_THICR | S-adenosylmethionine synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-128 |
| sp|Q0AEV7|METK_NITEC | S-adenosylmethionine synthase OS=Nitrosomonas eutropha (strain C91) GN=metK PE=3 SV=1 | 16 | 374 | 2.0E-128 |
| sp|A4T0F0|METK_POLSQ | S-adenosylmethionine synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=metK PE=3 SV=1 | 17 | 374 | 2.0E-128 |
| sp|Q12FG9|METK_POLSJ | S-adenosylmethionine synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metK PE=3 SV=1 | 17 | 374 | 3.0E-128 |
| sp|B0TUB8|METK_SHEHH | S-adenosylmethionine synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-128 |
| sp|A5FRV2|METK_DEHMB | S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-128 |
| sp|B9MDD1|METK_ACIET | S-adenosylmethionine synthase OS=Acidovorax ebreus (strain TPSY) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-128 |
| sp|C4K3W7|METK_HAMD5 | S-adenosylmethionine synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-128 |
| sp|Q1J1P4|METK_DEIGD | S-adenosylmethionine synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-128 |
| sp|B0VC98|METK_ACIBY | S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain AYE) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-128 |
| sp|A9EXT3|METK_SORC5 | S-adenosylmethionine synthase OS=Sorangium cellulosum (strain So ce56) GN=metK PE=3 SV=1 | 16 | 404 | 5.0E-128 |
| sp|Q146W0|METK_BURXL | S-adenosylmethionine synthase OS=Burkholderia xenovorans (strain LB400) GN=metK PE=3 SV=1 | 17 | 374 | 5.0E-128 |
| sp|C1CY25|METK_DEIDV | S-adenosylmethionine synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=metK PE=3 SV=1 | 18 | 374 | 5.0E-128 |
| sp|A9KD87|METK_COXBN | S-adenosylmethionine synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-128 |
| sp|Q8D2N8|METK_WIGBR | S-adenosylmethionine synthase OS=Wigglesworthia glossinidia brevipalpis GN=metK PE=3 SV=1 | 16 | 373 | 6.0E-128 |
| sp|A3M4V2|METK_ACIBT | S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=metK PE=3 SV=2 | 18 | 374 | 6.0E-128 |
| sp|B0VR30|METK_ACIBS | S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain SDF) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-128 |
| sp|B2HYY9|METK_ACIBC | S-adenosylmethionine synthase OS=Acinetobacter baumannii (strain ACICU) GN=metK PE=3 SV=1 | 18 | 374 | 6.0E-128 |
| sp|A5GJ24|METK_SYNPW | S-adenosylmethionine synthase OS=Synechococcus sp. (strain WH7803) GN=metK PE=3 SV=1 | 17 | 366 | 7.0E-128 |
| sp|B3PGF2|METK_CELJU | S-adenosylmethionine synthase OS=Cellvibrio japonicus (strain Ueda107) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-128 |
| sp|A1TKT9|METK_ACIAC | S-adenosylmethionine synthase OS=Acidovorax citrulli (strain AAC00-1) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-128 |
| sp|B2T1P7|METK_BURPP | S-adenosylmethionine synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metK PE=3 SV=1 | 17 | 374 | 7.0E-128 |
| sp|Q7U4S6|METK_SYNPX | S-adenosylmethionine synthase OS=Synechococcus sp. (strain WH8102) GN=metK PE=3 SV=1 | 17 | 368 | 8.0E-128 |
| sp|Q83A78|METK_COXBU | S-adenosylmethionine synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metK PE=3 SV=1 | 18 | 374 | 8.0E-128 |
| sp|P50303|METK3_ACTCH | S-adenosylmethionine synthase 3 (Fragment) OS=Actinidia chinensis GN=SAM3 PE=2 SV=1 | 47 | 374 | 9.0E-128 |
| sp|A9N9E2|METK_COXBR | S-adenosylmethionine synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-127 |
| sp|B6J3Q9|METK_COXB2 | S-adenosylmethionine synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-127 |
| sp|A1W3X4|METK_ACISJ | S-adenosylmethionine synthase OS=Acidovorax sp. (strain JS42) GN=metK PE=3 SV=1 | 17 | 374 | 1.0E-127 |
| sp|A1U547|METK_MARHV | S-adenosylmethionine synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metK PE=3 SV=1 | 18 | 374 | 1.0E-127 |
| sp|B8D7U1|METK_BUCAT | S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=metK PE=3 SV=1 | 16 | 373 | 1.0E-127 |
| sp|P57486|METK_BUCAI | S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metK PE=3 SV=1 | 16 | 373 | 1.0E-127 |
| sp|B8D9I9|METK_BUCA5 | S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=metK PE=3 SV=1 | 16 | 373 | 1.0E-127 |
| sp|Q5YTN0|METK_NOCFA | S-adenosylmethionine synthase OS=Nocardia farcinica (strain IFM 10152) GN=metK PE=3 SV=1 | 13 | 374 | 3.0E-127 |
| sp|Q741G5|METK_MYCPA | S-adenosylmethionine synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-127 |
| sp|B0REV4|METK_CLAMS | S-adenosylmethionine synthase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=metK PE=3 SV=1 | 18 | 374 | 3.0E-127 |
| sp|A1K301|METK_AZOSB | S-adenosylmethionine synthase OS=Azoarcus sp. (strain BH72) GN=metK PE=3 SV=1 | 16 | 374 | 3.0E-127 |
| sp|B6J6H0|METK_COXB1 | S-adenosylmethionine synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-127 |
| sp|B0TX15|METK_FRAP2 | S-adenosylmethionine synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=metK PE=3 SV=1 | 16 | 374 | 5.0E-127 |
| sp|Q3AWE6|METK_SYNS9 | S-adenosylmethionine synthase OS=Synechococcus sp. (strain CC9902) GN=metK PE=3 SV=1 | 17 | 368 | 5.0E-127 |
| sp|Q0S0L4|METK_RHOJR | S-adenosylmethionine synthase OS=Rhodococcus jostii (strain RHA1) GN=metK PE=3 SV=1 | 15 | 374 | 5.0E-127 |
| sp|A7HJA9|METK_FERNB | S-adenosylmethionine synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=metK PE=3 SV=1 | 18 | 374 | 7.0E-127 |
| sp|C0ZZD4|METK_RHOE4 | S-adenosylmethionine synthase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=metK PE=3 SV=1 | 15 | 374 | 7.0E-127 |
| sp|C1B4J7|METK_RHOOB | S-adenosylmethionine synthase OS=Rhodococcus opacus (strain B4) GN=metK PE=3 SV=1 | 15 | 374 | 7.0E-127 |
| sp|Q82WL2|METK_NITEU | S-adenosylmethionine synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metK PE=3 SV=1 | 16 | 374 | 8.0E-127 |
| sp|Q3Z943|METK_DEHM1 | S-adenosylmethionine synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=metK PE=3 SV=1 | 17 | 374 | 9.0E-127 |
| sp|Q7V5A2|METK_PROMM | S-adenosylmethionine synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=metK PE=3 SV=1 | 17 | 368 | 1.0E-126 |
| sp|A9BXF7|METK_DELAS | S-adenosylmethionine synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=metK PE=3 SV=1 | 17 | 374 | 2.0E-126 |
| sp|Q8K9E5|METK_BUCAP | S-adenosylmethionine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metK PE=3 SV=1 | 16 | 373 | 2.0E-126 |
| sp|A0QI26|METK_MYCA1 | S-adenosylmethionine synthase OS=Mycobacterium avium (strain 104) GN=metK PE=1 SV=1 | 18 | 374 | 3.0E-126 |
| sp|A5GR07|METK_SYNR3 | S-adenosylmethionine synthase OS=Synechococcus sp. (strain RCC307) GN=metK PE=3 SV=1 | 17 | 368 | 3.0E-126 |
| sp|A4IWA4|METK_FRATW | S-adenosylmethionine synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-126 |
| sp|B1XSH9|METK_POLNS | S-adenosylmethionine synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=metK PE=3 SV=1 | 17 | 374 | 4.0E-126 |
| sp|B5EN11|METK_ACIF5 | S-adenosylmethionine synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-126 |
| sp|B7J551|METK_ACIF2 | S-adenosylmethionine synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metK PE=3 SV=1 | 18 | 374 | 4.0E-126 |
| sp|Q0BKD0|METK_FRATO | S-adenosylmethionine synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-126 |
| sp|A0Q862|METK_FRATN | S-adenosylmethionine synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-126 |
| sp|B2SFE1|METK_FRATM | S-adenosylmethionine synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-126 |
| sp|Q2A1N2|METK_FRATH | S-adenosylmethionine synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metK PE=3 SV=1 | 16 | 374 | 4.0E-126 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006556 | S-adenosylmethionine biosynthetic process | Yes |
| GO:0004478 | methionine adenosyltransferase activity | Yes |
| GO:0009058 | biosynthetic process | No |
| GO:0046500 | S-adenosylmethionine metabolic process | No |
| GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | No |
| GO:0009987 | cellular process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0003824 | catalytic activity | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0016740 | transferase activity | No |
| GO:0006790 | sulfur compound metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0003674 | molecular_function | No |
| GO:0044272 | sulfur compound biosynthetic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 28 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|054510 MTANGSAVHATLTPGHFLFTSESVGEGHPDKICDQVSDAILDACLSEDPFSKVACETAAKTGMIMVFGEITTKAK IDYQKVIRETIKKIGYDDSSKGFDYKTCNILVAIEQQSPDIAQGLDHGSLESHGAGDQGIMFGYATDETPECMPL TILLAHKLNASMALARRAGVLPWLRPDSKTQVTVEYKKEGGAMIPLRVDTIVISTQHAEEISTEDLRREIKEKII KQVIPANLLDERTIYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDFSKVDRSAAYTARWIA KSLVSASLARRALVQLSYAIGVAEPLSIYVDTYGTGKKTDEELVQIIRKNWDLRPGVIVRELDLQKPQYLKTASK FILPPSSLHCADSPIPLTPSFPHPTMCGILGLLLHDPTVNVAAEIAEGLSLLQHRGQDACGIITCGPKGRFYQCK ANGMVRDIFDDSSIARLIGGMGVGHVRYPTAGSFNNAEAQPFYVNSPYGIVFAHNGNLINTSSLMQFMDQVSHRH INTASDSELLLNIFADNLQKTGKFRINEEDIFTAIGGVVSQCKGAYACVAMLAGFGIIAFRDPNGIRPVGMASRK TANGEGSDYIFASESVVADACGFTDWEDVKPGEAVIITRNGVSRRQVSTPSTLAPDIFEYVYFARPDSVIDGVSV YRSRMAMGDVLAEKVKRVLEENNLTVDVVIPVPDTSRVAALNLAQKLALPYREGFIKNRYVGRTFIMPGQQMRKK NVRRKLNAMALEFADKNVLLVDDSIVRGTTSKEIVQMAKDVGAKKVIVASCAPPIRYPNVYGIDMPSRKELVAYG RNEVEIAKAIGADLVVFQSLPDLVESVRHLNTSINAFDCSVFTGDYITGGVTEEYLQHVEGLRSDNNRLKLNLDT NVLQSDVVNGYPNGHAAESGPPSSTAGLDDSVGLHNTWKSN* |
| Coding | >AgabiH97|054510 ATGACTGCCAACGGATCCGCCGTCCATGCCACCTTGACCCCTGGTCATTTTCTGTTCACCTCCGAATCCGTCGGT GAAGGACATCCTGATAAAATTTGTGACCAGGTCTCTGATGCCATCCTCGATGCGTGTTTAAGCGAGGACCCTTTC TCCAAGGTCGCCTGCGAGACTGCCGCCAAGACCGGCATGATCATGGTCTTTGGGGAGATCACAACCAAGGCTAAG ATCGACTATCAAAAGGTCATCAGAGAAACCATCAAGAAAATTGGTTACGATGACTCCTCCAAGGGATTTGACTAC AAAACCTGCAATATTCTAGTCGCTATTGAACAGCAATCACCTGACATTGCTCAGGGCTTGGATCACGGATCGCTC GAGAGCCATGGTGCTGGTGATCAGGGTATCATGTTCGGCTATGCGACGGACGAGACTCCGGAGTGTATGCCATTG ACGATTCTGCTTGCGCATAAGCTTAATGCTTCTATGGCTCTTGCTCGCCGAGCTGGTGTGCTTCCTTGGCTCCGC CCTGACTCTAAGACTCAGGTCACCGTTGAGTACAAGAAAGAGGGTGGTGCAATGATCCCTCTACGTGTTGATACC ATTGTCATTTCTACCCAACACGCTGAGGAGATTTCTACGGAAGACCTCCGTCGCGAGATCAAGGAGAAGATTATC AAACAAGTCATTCCAGCCAACCTCCTGGACGAGCGGACTATCTATCATATCCAACCTTCCGGTCGTTTCGTGATT GGTGGTCCTCAGGGTGATGCTGGCCTTACTGGCCGCAAGATCATTGTTGATACCTATGGTGGATGGGGTGCCCAC GGTGGAGGTGCTTTCTCTGGAAAGGACTTTTCCAAGGTCGATCGCTCTGCTGCTTATACTGCACGCTGGATTGCC AAATCTCTTGTTTCTGCTAGCCTCGCTCGCCGTGCGCTTGTTCAGCTTTCCTATGCCATTGGTGTTGCGGAGCCC CTGTCGATCTATGTTGATACCTACGGCACCGGAAAGAAGACCGATGAAGAGCTGGTCCAGATCATTCGTAAGAAC TGGGATCTCCGACCTGGTGTCATTGTACGAGAGCTCGATCTCCAAAAGCCACAATACCTGAAGACTGCATCGAAG TTCATCCTTCCGCCATCATCGTTGCATTGTGCTGATTCCCCGATACCACTCACACCCTCTTTCCCTCACCCGACT ATGTGTGGCATCCTCGGTCTTCTTCTGCACGATCCGACTGTCAATGTCGCTGCAGAAATCGCAGAGGGTCTTTCC CTCCTCCAGCATCGTGGTCAGGATGCTTGTGGAATCATCACCTGTGGACCCAAGGGTCGTTTCTACCAGTGCAAA GCCAACGGCATGGTCCGTGATATCTTTGACGACAGCTCCATCGCGAGATTGATAGGCGGCATGGGAGTCGGACAT GTCCGGTATCCCACCGCCGGCAGCTTTAACAATGCCGAAGCTCAGCCATTCTACGTCAACTCACCCTATGGAATT GTCTTCGCTCATAATGGAAATCTTATCAACACCTCGTCCTTGATGCAATTCATGGACCAGGTTTCTCATAGACAT ATCAACACCGCATCGGATTCCGAGCTTCTCCTCAATATCTTTGCCGACAATCTTCAGAAGACAGGAAAATTTCGT ATCAATGAAGAGGACATCTTTACTGCAATTGGAGGTGTTGTATCACAATGCAAGGGCGCATATGCTTGCGTTGCT ATGCTCGCTGGTTTCGGTATCATTGCTTTTCGCGATCCGAATGGCATTAGGCCTGTTGGAATGGCTTCACGCAAA ACGGCGAACGGTGAAGGGTCGGATTATATTTTTGCTAGTGAAAGCGTAGTGGCGGATGCTTGTGGATTCACCGAT TGGGAGGACGTCAAACCCGGCGAAGCTGTGATCATTACACGGAATGGCGTCTCTCGGCGACAGGTTTCAACTCCC TCAACTTTGGCGCCGGATATCTTTGAATATGTGTATTTCGCACGACCGGATTCGGTTATTGATGGAGTGAGTGTC TACAGAAGTCGGATGGCTATGGGAGACGTTCTTGCAGAAAAAGTAAAACGGGTTTTGGAAGAAAATAATCTGACG GTGGACGTCGTGATTCCTGTCCCAGATACTTCCCGCGTCGCGGCTCTTAATCTTGCTCAGAAACTTGCTTTGCCT TATCGCGAAGGGTTCATCAAAAACCGCTACGTTGGTCGAACCTTCATCATGCCTGGGCAACAAATGAGGAAGAAG AACGTCCGTAGGAAGCTTAATGCTATGGCTTTGGAATTTGCAGACAAGAATGTCTTGCTTGTCGATGATTCCATT GTCAGAGGTACGACCTCTAAAGAGATCGTTCAGATGGCTAAGGATGTTGGTGCGAAGAAAGTCATCGTCGCTAGT TGTGCGCCACCTATTCGCTATCCCAACGTCTACGGCATTGATATGCCGTCTCGAAAAGAGCTCGTTGCCTACGGC CGTAACGAAGTTGAGATTGCCAAAGCGATTGGTGCCGATCTCGTCGTCTTCCAAAGTCTACCTGATCTCGTTGAG TCCGTTCGACACCTCAATACCAGCATAAACGCATTCGATTGCTCTGTCTTCACGGGTGACTACATCACTGGCGGG GTGACTGAAGAGTATCTCCAGCACGTCGAGGGATTACGCTCGGACAACAATAGATTGAAACTGAACCTCGATACC AACGTGCTTCAAAGCGACGTCGTTAATGGCTATCCGAACGGGCACGCCGCGGAAAGCGGCCCACCATCCAGTACG GCTGGCTTAGATGATTCAGTTGGACTGCACAACACCTGGAAATCCAACTAG |
| Transcript | >AgabiH97|054510 ATGACTGCCAACGGATCCGCCGTCCATGCCACCTTGACCCCTGGTCATTTTCTGTTCACCTCCGAATCCGTCGGT GAAGGACATCCTGATAAAATTTGTGACCAGGTCTCTGATGCCATCCTCGATGCGTGTTTAAGCGAGGACCCTTTC TCCAAGGTCGCCTGCGAGACTGCCGCCAAGACCGGCATGATCATGGTCTTTGGGGAGATCACAACCAAGGCTAAG ATCGACTATCAAAAGGTCATCAGAGAAACCATCAAGAAAATTGGTTACGATGACTCCTCCAAGGGATTTGACTAC AAAACCTGCAATATTCTAGTCGCTATTGAACAGCAATCACCTGACATTGCTCAGGGCTTGGATCACGGATCGCTC GAGAGCCATGGTGCTGGTGATCAGGGTATCATGTTCGGCTATGCGACGGACGAGACTCCGGAGTGTATGCCATTG ACGATTCTGCTTGCGCATAAGCTTAATGCTTCTATGGCTCTTGCTCGCCGAGCTGGTGTGCTTCCTTGGCTCCGC CCTGACTCTAAGACTCAGGTCACCGTTGAGTACAAGAAAGAGGGTGGTGCAATGATCCCTCTACGTGTTGATACC ATTGTCATTTCTACCCAACACGCTGAGGAGATTTCTACGGAAGACCTCCGTCGCGAGATCAAGGAGAAGATTATC AAACAAGTCATTCCAGCCAACCTCCTGGACGAGCGGACTATCTATCATATCCAACCTTCCGGTCGTTTCGTGATT GGTGGTCCTCAGGGTGATGCTGGCCTTACTGGCCGCAAGATCATTGTTGATACCTATGGTGGATGGGGTGCCCAC GGTGGAGGTGCTTTCTCTGGAAAGGACTTTTCCAAGGTCGATCGCTCTGCTGCTTATACTGCACGCTGGATTGCC AAATCTCTTGTTTCTGCTAGCCTCGCTCGCCGTGCGCTTGTTCAGCTTTCCTATGCCATTGGTGTTGCGGAGCCC CTGTCGATCTATGTTGATACCTACGGCACCGGAAAGAAGACCGATGAAGAGCTGGTCCAGATCATTCGTAAGAAC TGGGATCTCCGACCTGGTGTCATTGTACGAGAGCTCGATCTCCAAAAGCCACAATACCTGAAGACTGCATCGAAG TTCATCCTTCCGCCATCATCGTTGCATTGTGCTGATTCCCCGATACCACTCACACCCTCTTTCCCTCACCCGACT ATGTGTGGCATCCTCGGTCTTCTTCTGCACGATCCGACTGTCAATGTCGCTGCAGAAATCGCAGAGGGTCTTTCC CTCCTCCAGCATCGTGGTCAGGATGCTTGTGGAATCATCACCTGTGGACCCAAGGGTCGTTTCTACCAGTGCAAA GCCAACGGCATGGTCCGTGATATCTTTGACGACAGCTCCATCGCGAGATTGATAGGCGGCATGGGAGTCGGACAT GTCCGGTATCCCACCGCCGGCAGCTTTAACAATGCCGAAGCTCAGCCATTCTACGTCAACTCACCCTATGGAATT GTCTTCGCTCATAATGGAAATCTTATCAACACCTCGTCCTTGATGCAATTCATGGACCAGGTTTCTCATAGACAT ATCAACACCGCATCGGATTCCGAGCTTCTCCTCAATATCTTTGCCGACAATCTTCAGAAGACAGGAAAATTTCGT ATCAATGAAGAGGACATCTTTACTGCAATTGGAGGTGTTGTATCACAATGCAAGGGCGCATATGCTTGCGTTGCT ATGCTCGCTGGTTTCGGTATCATTGCTTTTCGCGATCCGAATGGCATTAGGCCTGTTGGAATGGCTTCACGCAAA ACGGCGAACGGTGAAGGGTCGGATTATATTTTTGCTAGTGAAAGCGTAGTGGCGGATGCTTGTGGATTCACCGAT TGGGAGGACGTCAAACCCGGCGAAGCTGTGATCATTACACGGAATGGCGTCTCTCGGCGACAGGTTTCAACTCCC TCAACTTTGGCGCCGGATATCTTTGAATATGTGTATTTCGCACGACCGGATTCGGTTATTGATGGAGTGAGTGTC TACAGAAGTCGGATGGCTATGGGAGACGTTCTTGCAGAAAAAGTAAAACGGGTTTTGGAAGAAAATAATCTGACG GTGGACGTCGTGATTCCTGTCCCAGATACTTCCCGCGTCGCGGCTCTTAATCTTGCTCAGAAACTTGCTTTGCCT TATCGCGAAGGGTTCATCAAAAACCGCTACGTTGGTCGAACCTTCATCATGCCTGGGCAACAAATGAGGAAGAAG AACGTCCGTAGGAAGCTTAATGCTATGGCTTTGGAATTTGCAGACAAGAATGTCTTGCTTGTCGATGATTCCATT GTCAGAGGTACGACCTCTAAAGAGATCGTTCAGATGGCTAAGGATGTTGGTGCGAAGAAAGTCATCGTCGCTAGT TGTGCGCCACCTATTCGCTATCCCAACGTCTACGGCATTGATATGCCGTCTCGAAAAGAGCTCGTTGCCTACGGC CGTAACGAAGTTGAGATTGCCAAAGCGATTGGTGCCGATCTCGTCGTCTTCCAAAGTCTACCTGATCTCGTTGAG TCCGTTCGACACCTCAATACCAGCATAAACGCATTCGATTGCTCTGTCTTCACGGGTGACTACATCACTGGCGGG GTGACTGAAGAGTATCTCCAGCACGTCGAGGGATTACGCTCGGACAACAATAGATTGAAACTGAACCTCGATACC AACGTGCTTCAAAGCGACGTCGTTAATGGCTATCCGAACGGGCACGCCGCGGAAAGCGGCCCACCATCCAGTACG GCTGGCTTAGATGATTCAGTTGGACTGCACAACACCTGGAAATCCAACTAG |
| Gene | >AgabiH97|054510 ATGACTGCCAACGGATCCGCCGTCCATGCCACCTTGACCCCTGGTCATTTTCTGTTCACCTCCGAATCCGTCGGT GAAGGACATCCTGGTACGTTGTTAGTTCGCGACGCGTATTGCGGAAATTGATTCGAAAATCCAGATAAAATTTGT GACCAGGTCTCTGATGCCATCGTCAGTACCAGCCTTTTTTTCTTTTCTAATTTTTTTTTATCGTTTTTGAATGTC ACTGGCATTTAACGCTCGCTTTTAAATAGCTCGATGCGTGTTTAAGCGAGGACCCTTTCTCCAAGGTCGCCTGCG AGACTGCCGCCAAGACCGGCATGATCATGGTCTTTGGGGAGATCACAACCAAGGCTAAGATCGACTATCAAAAGG TCATCAGAGAAACCATCAAGAAAATTGGTTACGATGACTCCTCCAAGGGATTTGACTACAAAACCTGCAATATTC TAGTCGCTATTGAACAGCAATCACCTGACATTGCTCAGGGCTTGGATCACGGATCGCTCGAGAGCCATGGTGCTG GTGATCAGGGTATCATGTTCGGCTATGCGACGGACGAGACTCCGGAGTGTATGCCATTGACGATTCTGCTTGCGC ATAAGCTTAATGCTTCTATGGCTCTTGCTCGCCGAGCTGGTGTGCTTCCTTGGCTCCGCCCTGACTCTAAGACTC AGGTCACCGTTGAGTACAAGAAAGAGGGTGGTGCAATGATCCCTCTACGTGTTGATACCATTGTCATTTCTACCC AACACGCTGAGGAGATTTCTACGGAAGACCTCCGTCGCGAGATCAAGGAGAAGATTATCAAACAAGTCATTCCAG CCAACCTCCTGGACGAGCGGACTATCTATCATGTGCGTGGCACTTTGTGTTTGATGTAATTCTGATATTGAAGTT TGATGTCTTGTTAGATCCAACCTTCCGGTCGTTTCGTGATTGGTGGTCCTCAGGGTGATGCTGGCCTTACTGGCC GCAAGATCATTGTTGATACCTATGGTGGATGGGGTGCCCACGGTGGAGGTGCTTTCTCTGGAAAGGACTTTTCCA AGGTCGATCGCTCTGCTGCTTATACTGCACGCTGGATTGGTAAATTTAACTCAACCACCGCTAAGATGGGGTTAC TGATGTCCGATTTACAGCCAAATCTCTTGTTTCTGCTAGCCTCGCTCGCCGTGCGCTTGTTCAGCTTTCCTATGC CATTGGTGTTGCGGAGCCCCTGTCGATCTATGTTGATACCTACGGCACCGGAAAGAAGACCGATGAAGAGCTGGT CCAGATCATTCGTAAGAACTGGGATCTCCGACCTGGTGTCATTGGTGAGTTTACTATATATGCTTTGGAGTTGGA ACTCACGCCATTTCTCAGTACGAGAGCTCGATCTCCAAAAGCCACAATACCTGAAGACTGCATCGTACGGCCACT TTGGTAACCCTGACTACTCCTGGGAGAAACCAAAGAAGCTCAGACTATAGAAGGCTGAATCAGATCTTGATATGA TATGCACTCATTTATTATATTTTCGAGTGTTTTCTTGCATAGGAAGTTCATCCTTCCGCCATCATCGTTGCATTG TGCTGATTCCCCGATACCACTCACACCCTCTTTCCCTGTACTTACCTTGTACACTCTGTGGAATTTAAACTACCC CCGTTATAGTTTGTAATTAGACGAATAGACCTGCGTTCAACCGCTGAAATGAACTGATAAGCGGATTATCGGAAA CGGAAATTTTTTGACGACGCACGTGGGGGGGCTCCGCTGATAACTGGCTGCTGGCTGGGCTGAGTGCCTAAATGT TTCCCCACCAACAACAGTTTCTCCTGAGCGCCTAGCACCCGACTAGTGCGAGCCCCCTTTTTCTGCTCTGACTCT TGGCTTACCATCTACACAGTGTGTGGCATCCTCGGTCTTCTTCTGCACGATCCGACTGTCAATGTCGCTGCAGAA ATCGCAGAGGGTCTTTCCCTCCTCCAGCATCGTGGTCAGGATGCTTGTGGAATCATCACCTGTGGACCCAAGGGT CGTTTCTACCAGTGCAAAGCCAACGGCATGGTCCGTGATATCTTTGACGACAGCTCCATCGCGAGATTGATAGGC GGCATGGGAGTCGGACATGGTGTGTTCTGTTCATCAATCAGACACTGCCATAGCATATTCAATTACTTGTAGTCC GGTATCCCACCGCCGGCAGCTTTAACAATGCCGAAGCTCAGCCATTCTACGTCAACTCACCCTATGGAATTGTCT TCGCTCATGTAAAATCTGATATTCCGTGCCGGTCACATACTGGAGCTCACGACATGTTGTAGAATGGAAATCTTA TCAACACCTCGTCCTTGATGCAATTCATGGACCAGGTTTCTCATAGACATATCAACACCGCATCGGATTCCGAGC TTCTCCTCAATATCTTTGCCGACAATCTTCAGAAGACAGGAAAATTTCGTATCAATGAAGAGGACATCTTTACTG CAATTGGAGGTGTTGTATCACAATGCAAGGGCGCATATGCTTGCGTTGCTATGCTCGCTGGTTTCGGTATCATTG CTTTTCGCGATCCGAATGGCATTAGGCCTGTTGGAATGGCTTCACGCAAAACGGCGAACGGTGAAGGGTCGGATT ATATTTTTGCTAGTGAAAGCGTAGTGGCGGATGCTTGTGGATTCACCGATTGGGAGGACGTCAAACCCGGTAAGT CAAGTTCAGTTTGGCATTCGTATCATAAATCTTACACCTTGCGCCTAGGCGAAGCTGTGATCATTACACGGAATG GCGTCTCTCGGCGACAGGTTTCAACTCCCTCAACTTTGGCGCCGGATATCTTTGAATATGTGTATTTCGCACGAC CGGATTCGGTTATTGATGGAGTGAGTGTCTACAGAAGTCGGATGGCTATGGGAGACGTTCTTGCAGAAAAAGTAA AACGGGTTTTGGAAGAAAATAATCTGACGGTGGACGTCGTGATTCCTGCAAGTGATGTTAATTTCGCGTGTCGTG TTCTGTGCTCAGACAAAGCAGGTCCCAGATACTTCCCGCGTCGCGGCTCTTAATCTTGCTCAGAAACTTGCTTTG CCTTATCGCGAAGGGTTCATCAAAAACCGCTACGTTGGTCGAACCTTCATCATGCCTGGGCAACAAATGAGGAAG AAGAACGTCCGTAGGAAGCTTAATGCTATGGCTTTGGAATTTGCAGACAAGAATGTCTTGCTTGTCGATGGTGAG TACCGTGCTATCGTATATCATCATATATGCTGATGGACAGCAGATTCCATTGTCAGAGGTACGACCTCTAAAGAG ATCGTTCAGATGGCTAAGGATGTTGGTGCGAAGAAAGTCATCGTCGCTAGTTGTGCGCCACCTATTCGGTCAGTT ATGTCCTCATTTTGACTTGATATAATATCTAGACTTAGCCTTCTTTCCTCTAGCTATCCCAACGTCTACGGCATT GATATGCCGTCTCGAAAAGAGCTCGTTGCCTACGGCCGTAACGAAGTTGAGATTGCCAAAGCGATTGGTGCCGAT CTCGTCGTCTTCCAAAGTCTACCTGATCTCGTTGAGTCCGTTCGACACCTCAATACCAGCATAAACGCATTCGAT TGCTCTGTCTTCACGGGTGACTACATCACTGGCGGGGTGACTGAAGAGTATCTCCAGCACGTCGAGGGATTACGC TCGGACAACAATAGATTGAAACTGAACCTCGATACCAACGTGCTTCAAAGCGACGTCGTTAATGGCTATCCGAAC GGGCACGCCGCGGAAAGCGGCCCACCATCCAGTACGGCTGGCTTAGATGATTCAGTTGGACTGCACAACACCTGG AAATCCAACTAG |