Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|054280
Gene name
Locationscaffold_3:435038..435953
Strand+
Gene length (bp)915
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 2.1E-07 246 286
PF07653 SH3_2 Variant SH3 domain 7.7E-05 241 289

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 129 151 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|054280
MHSRFTRKGIHRRVAGLEPEDEMEKRDLTGPVTITLAIPLDTDTPIPTPQPLPTLLPTQSLESPPLEPTFSSSPP
QPSTTPQGPVGGISPPESTSSTSSAMTAISSSPTGAISAGNDPQDPQHAPKLSSGAIAGIVIGCLVVLIIATALG
LRKRTVNNRLKLRGMWAGSKSLQMRNQSRQSRYEAMPDLNNNGENMGFVGKQGASLGQPTSPRALPSAYGSEEMN
SSGPTSQKIPVLYNTVVARSYVPTLPDELAISTGETLKVLQEFDDGWSECMNSAGEVGMVPLECFGKERGFGRQT
SLGR*
Coding >AgabiH97|054280
ATGCATAGCAGATTTACTAGGAAAGGAATTCATCGAAGGGTAGCCGGTCTTGAGCCGGAGGATGAGATGGAGAAG
AGAGATCTCACAGGCCCAGTTACTATCACTCTGGCTATTCCGCTTGATACAGACACGCCCATCCCGACACCACAA
CCACTACCGACTCTATTACCGACACAGTCCCTAGAATCACCTCCCCTTGAACCGACATTTTCCTCATCTCCTCCG
CAACCTTCGACGACACCCCAGGGGCCGGTGGGCGGTATCTCACCGCCGGAAAGCACCTCTTCGACATCATCAGCC
ATGACAGCCATATCAAGTAGTCCTACAGGGGCCATTTCAGCCGGAAACGACCCCCAGGACCCCCAACACGCTCCC
AAACTCTCATCAGGCGCAATTGCAGGCATTGTCATTGGCTGTCTTGTTGTCCTCATCATTGCCACCGCTCTGGGA
CTCCGCAAACGAACGGTTAACAACCGACTAAAATTACGTGGAATGTGGGCTGGTTCAAAATCGCTGCAGATGCGA
AATCAGAGCAGACAATCAAGATACGAGGCCATGCCCGATTTGAATAACAATGGAGAAAATATGGGATTTGTGGGA
AAACAAGGTGCCTCGCTTGGGCAGCCGACATCGCCGAGGGCGTTGCCTTCCGCTTATGGGTCTGAGGAAATGAAC
AGCAGTGGGCCGACGAGTCAGAAGATACCGGTGCTGTACAACACGGTGGTTGCTCGGTCGTATGTGCCGACGCTG
CCGGACGAGCTGGCGATATCGACGGGAGAGACGCTGAAGGTGCTGCAGGAGTTTGACGACGGGTGGTCCGAGTGC
ATGAATTCTGCGGGAGAGGTGGGAATGGTGCCGCTGGAGTGTTTTGGGAAGGAGCGCGGCTTTGGGCGGCAGACG
AGCCTGGGACGCTGA
Transcript >AgabiH97|054280
ATGCATAGCAGATTTACTAGGAAAGGAATTCATCGAAGGGTAGCCGGTCTTGAGCCGGAGGATGAGATGGAGAAG
AGAGATCTCACAGGCCCAGTTACTATCACTCTGGCTATTCCGCTTGATACAGACACGCCCATCCCGACACCACAA
CCACTACCGACTCTATTACCGACACAGTCCCTAGAATCACCTCCCCTTGAACCGACATTTTCCTCATCTCCTCCG
CAACCTTCGACGACACCCCAGGGGCCGGTGGGCGGTATCTCACCGCCGGAAAGCACCTCTTCGACATCATCAGCC
ATGACAGCCATATCAAGTAGTCCTACAGGGGCCATTTCAGCCGGAAACGACCCCCAGGACCCCCAACACGCTCCC
AAACTCTCATCAGGCGCAATTGCAGGCATTGTCATTGGCTGTCTTGTTGTCCTCATCATTGCCACCGCTCTGGGA
CTCCGCAAACGAACGGTTAACAACCGACTAAAATTACGTGGAATGTGGGCTGGTTCAAAATCGCTGCAGATGCGA
AATCAGAGCAGACAATCAAGATACGAGGCCATGCCCGATTTGAATAACAATGGAGAAAATATGGGATTTGTGGGA
AAACAAGGTGCCTCGCTTGGGCAGCCGACATCGCCGAGGGCGTTGCCTTCCGCTTATGGGTCTGAGGAAATGAAC
AGCAGTGGGCCGACGAGTCAGAAGATACCGGTGCTGTACAACACGGTGGTTGCTCGGTCGTATGTGCCGACGCTG
CCGGACGAGCTGGCGATATCGACGGGAGAGACGCTGAAGGTGCTGCAGGAGTTTGACGACGGGTGGTCCGAGTGC
ATGAATTCTGCGGGAGAGGTGGGAATGGTGCCGCTGGAGTGTTTTGGGAAGGAGCGCGGCTTTGGGCGGCAGACG
AGCCTGGGACGCTGA
Gene >AgabiH97|054280
ATGCATAGCAGATTTACTAGGAAAGGAATTCATCGAAGGGTAGCCGGTCTTGAGCCGGAGGATGAGATGGAGAAG
AGAGATCTCACAGGCCCAGTTACTATCACTCTGGCTATTCCGCTTGATACAGACACGCCCATCCCGACACCACAA
CCACTACCGACTCTATTACCGACACAGTCCCTAGAATCACCTCCCCTTGAACCGACATTTTCCTCATCTCCTCCG
CAACCTTCGACGACACCCCAGGGGCCGGTGGGCGGTATCTCACCGCCGGAAAGCACCTCTTCGACATCATCAGCC
ATGACAGCCATATCAAGTAGTCCTACAGGGGCCATTTCAGCCGGAAACGACCCCCAGGACCCCCAACACGCTCCC
AAACTCTCATCAGGCGCAATTGCAGGCATTGTCATTGGCTGTCTTGTTGTCCTCATCATTGCCACCGCTCTGGGA
CTCCGCAAACGAACGGTTAACAACCGACTAAAATTACGTGGAATGTGGGCTGGTTCAAAATCGCTGCAGATGCGA
AATCAGAGCAGACAATCAAGATACGAGGCCATGCCCGATTTGAATAACAATGGAGAAAATATGGGATTTGTGGGA
AAACAAGGTGCCTCGCTTGGGCAGCCGACATCGCCGAGGGCGTTGCCTTCCGCTTATGGGTCTGAGGAAATGAAC
AGCAGTGGGCCGACGAGTCAGAAGATACCGGTGCTGTACAACACGGTGGTTGCTCGGTCGTATGTGCCGACGCTG
CCGGACGAGCTGGCGATATCGACGGGAGAGACGCTGAAGGTGCTGCAGGAGTTTGACGACGGGTGGTCCGAGTGC
ATGAATTCTGCGGGAGAGGTGGGAATGGTGCCGCTGGAGTGTTTTGGGAAGGAGCGCGGCTTTGGGCGGCAGACG
AGCCTGGGACGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail