Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|053690
Gene name
Locationscaffold_3:297291..297988
Strand-
Gene length (bp)697
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.1E-46 26 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 24 191 8.0E-46
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 24 184 2.0E-45
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 5 180 7.0E-36
sp|B8NCM8|CUTI3_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_039350 PE=3 SV=1 26 195 2.0E-29
sp|Q2U199|CUTI3_ASPOR Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000113 PE=3 SV=1 26 195 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8TGB8|CUTI_MONFR Cutinase OS=Monilinia fructicola GN=CUT1 PE=2 SV=1 24 191 8.0E-46
sp|Q00298|CUTI_BOTFU Cutinase OS=Botryotinia fuckeliana GN=cutA PE=3 SV=1 24 184 2.0E-45
sp|Q9Y7G8|CUTI_PYRBR Cutinase OS=Pyrenopeziza brassicae PE=3 SV=1 5 180 7.0E-36
sp|B8NCM8|CUTI3_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_039350 PE=3 SV=1 26 195 2.0E-29
sp|Q2U199|CUTI3_ASPOR Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000113 PE=3 SV=1 26 195 6.0E-29
sp|Q4W9Z4|CUTI3_ASPFU Probable cutinase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G03210 PE=3 SV=1 11 195 1.0E-27
sp|B0YEP5|CUTI3_ASPFC Probable cutinase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_099910 PE=3 SV=1 11 195 1.0E-27
sp|A2R2W3|CUTI1_ASPNC Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An14g02170 PE=3 SV=1 2 195 4.0E-27
sp|Q0CNE3|CUTI3_ASPTN Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04791 PE=3 SV=2 25 195 1.0E-26
sp|Q4X1N0|CUTI1_ASPFU Probable cutinase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09380 PE=3 SV=1 26 195 7.0E-26
sp|B0XRY3|CUTI1_ASPFC Probable cutinase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_025250 PE=3 SV=1 26 195 7.0E-26
sp|Q5AX00|CUTI3_EMENI Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7180 PE=2 SV=1 26 195 1.0E-25
sp|Q5B2C1|CUTI1_EMENI Probable cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5309 PE=3 SV=1 26 195 3.0E-25
sp|Q8X1P1|CUTI_BLUGH Cutinase OS=Blumeria graminis f. sp. hordei GN=CUT1 PE=3 SV=1 26 195 3.0E-25
sp|A1C9G0|CUTI3_ASPCL Probable cutinase 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055320 PE=3 SV=1 2 195 9.0E-25
sp|A1D9W1|CUTI3_NEOFI Probable cutinase 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_030250 PE=3 SV=1 20 195 3.0E-24
sp|A1DGN0|CUTI1_NEOFI Probable cutinase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_084890 PE=3 SV=1 26 195 6.0E-24
sp|Q4WQV2|CUTI2_ASPFU Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G14120 PE=3 SV=1 26 195 1.0E-23
sp|B0Y537|CUTI2_ASPFC Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_071270 PE=3 SV=1 26 195 1.0E-23
sp|Q5AVY9|CUTI2_EMENI Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7541 PE=2 SV=2 26 195 2.0E-23
sp|A1CVT3|CUTI2_NEOFI Probable cutinase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_102190 PE=3 SV=1 26 195 2.0E-23
sp|Q0CES4|CUTI2_ASPTN Probable cutinase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_07810 PE=3 SV=1 26 195 3.0E-23
sp|A1CSZ4|CUTI1_ASPCL Probable cutinase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_081180 PE=3 SV=1 26 195 4.0E-23
sp|Q0CD01|CUTI1_ASPTN Probable cutinase 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_08433 PE=3 SV=1 26 195 6.0E-23
sp|Q0CRP4|CUTI5_ASPTN Probable cutinase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03640 PE=3 SV=1 1 193 6.0E-23
sp|Q0CW01|CUTI4_ASPTN Probable cutinase 4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_02133 PE=3 SV=1 25 195 6.0E-23
sp|Q2TZY7|CUTI2_ASPOR Probable cutinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000665 PE=3 SV=1 26 195 2.0E-22
sp|B6H2E9|CUTI2_PENRW Probable cutinase 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc13g05110 PE=3 SV=1 26 195 4.0E-22
sp|P52956|CUTI1_ASPOR Cutinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cutL PE=1 SV=1 7 195 5.0E-22
sp|B8MVS3|CUTI1_ASPFN Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_072700 PE=3 SV=1 7 195 5.0E-22
sp|B8NBB2|CUTI2_ASPFN Probable cutinase 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_044870 PE=3 SV=2 26 195 9.0E-22
sp|P41744|CUTI_ALTBR Cutinase OS=Alternaria brassicicola GN=CUTAB1 PE=2 SV=1 22 180 8.0E-20
sp|Q99174|CUTI_FUSSC Cutinase OS=Fusarium solani subsp. cucurbitae GN=CUTA PE=3 SV=1 6 195 4.0E-19
sp|Q96US9|CUTI3_FUSSO Cutinase 3 OS=Fusarium solani subsp. pisi GN=CUT3 PE=3 SV=1 26 195 5.0E-19
sp|Q96UT0|CUTI2_FUSSO Cutinase 2 OS=Fusarium solani subsp. pisi GN=CUT2 PE=3 SV=1 26 195 1.0E-18
sp|P11373|CUTI1_COLGL Cutinase 1 OS=Colletotrichum gloeosporioides GN=CUTA PE=1 SV=1 22 188 5.0E-18
sp|P00590|CUTI1_FUSSO Cutinase 1 OS=Fusarium solani subsp. pisi GN=CUT1 PE=1 SV=1 26 195 9.0E-18
sp|P10951|CUTI_COLCA Cutinase OS=Colletotrichum capsici GN=CUTA PE=1 SV=1 26 188 1.0E-17
sp|B6HLS9|CUTI1_PENRW Probable cutinase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc21g21220 PE=3 SV=1 26 195 1.0E-17
sp|A5ABE6|CUTI2_ASPNC Probable cutinase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g00110 PE=3 SV=1 26 194 1.0E-17
sp|P9WP43|CUT1_MYCTU Probable cutinase Rv1984c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1984c PE=1 SV=1 9 195 3.0E-17
sp|P9WP42|CUT1_MYCTO Probable cutinase MT2037 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2037 PE=3 SV=1 9 195 3.0E-17
sp|P63880|CUT1_MYCBO Probable cutinase Mb2006c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2006c PE=3 SV=1 9 195 3.0E-17
sp|P30272|CUTI_MAGO7 Cutinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CUT1 PE=3 SV=3 26 180 2.0E-16
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 26 195 8.0E-16
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 26 195 9.0E-16
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 26 195 9.0E-16
sp|P29292|CUTI_DIDRA Cutinase OS=Didymella rabiei GN=CUT PE=2 SV=1 26 180 2.0E-14
sp|P9WP41|CUT2_MYCTU Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut2 PE=1 SV=1 26 167 3.0E-10
sp|P9WP40|CUT2_MYCTO Probable cutinase cut2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut2 PE=3 SV=1 26 167 3.0E-10
sp|P63882|CUT2_MYCBO Probable cutinase cut2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut2 PE=3 SV=1 26 167 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|053690
MFKAGFLAVILSTLAYAAPFSSRQLCADVTVVFARGTNEIPPIGQFVGPPFAGALVAQLGGRSLNFVGVDYAAVV
GGFLVGGDPQGARNMASDVTSFANACPDTAIVMSGYSQGAQLVHLSANQISSSVQEKVKAVVVFGDPDNGDGFPG
VLNSRSITFCAIGDTICDGGIIVFPPHFTYGLNVGEAAAFVVSHL*
Coding >AgabiH97|053690
ATGTTCAAAGCCGGTTTCCTCGCCGTTATTCTCTCTACGCTTGCATACGCAGCACCATTCAGCTCTCGCCAATTA
TGTGCTGACGTCACTGTTGTCTTCGCCAGAGGCACTAACGAGATTCCACCTATTGGTCAATTTGTCGGACCACCC
TTCGCGGGTGCGCTCGTAGCACAACTTGGAGGGAGGTCTTTGAATTTCGTTGGTGTGGACTATGCTGCCGTCGTA
GGTGGCTTCCTGGTGGGGGGTGATCCGCAAGGTGCTCGCAACATGGCTAGTGATGTTACCTCATTTGCAAATGCA
TGCCCGGATACCGCTATCGTCATGTCTGGCTATAGTCAAGGGGCCCAACTTGTGCACCTTTCCGCAAACCAGATT
TCTTCTTCCGTTCAGGAAAAGGTGAAGGCCGTCGTGGTTTTCGGTGATCCAGATAATGGCGACGGCTTCCCTGGT
GTATTGAATAGTCGCTCGATTACTTTTTGTGCAATTGGTGACACTATTTGTGATGGAGGCATCATTGTCTTTCCA
CCTCATTTTACCTATGGCCTGAATGTCGGAGAAGCAGCCGCTTTCGTGGTTTCTCATCTTTGA
Transcript >AgabiH97|053690
ATGTTCAAAGCCGGTTTCCTCGCCGTTATTCTCTCTACGCTTGCATACGCAGCACCATTCAGCTCTCGCCAATTA
TGTGCTGACGTCACTGTTGTCTTCGCCAGAGGCACTAACGAGATTCCACCTATTGGTCAATTTGTCGGACCACCC
TTCGCGGGTGCGCTCGTAGCACAACTTGGAGGGAGGTCTTTGAATTTCGTTGGTGTGGACTATGCTGCCGTCGTA
GGTGGCTTCCTGGTGGGGGGTGATCCGCAAGGTGCTCGCAACATGGCTAGTGATGTTACCTCATTTGCAAATGCA
TGCCCGGATACCGCTATCGTCATGTCTGGCTATAGTCAAGGGGCCCAACTTGTGCACCTTTCCGCAAACCAGATT
TCTTCTTCCGTTCAGGAAAAGGTGAAGGCCGTCGTGGTTTTCGGTGATCCAGATAATGGCGACGGCTTCCCTGGT
GTATTGAATAGTCGCTCGATTACTTTTTGTGCAATTGGTGACACTATTTGTGATGGAGGCATCATTGTCTTTCCA
CCTCATTTTACCTATGGCCTGAATGTCGGAGAAGCAGCCGCTTTCGTGGTTTCTCATCTTTGA
Gene >AgabiH97|053690
ATGTTCAAAGCCGGTTTCCTCGCCGTTATTCTCTCTACGCTTGCATACGCAGCACCATTCAGCTCTCGCCAATTA
TGTGCTGACGTCACTGTTGTCTTCGCCAGAGGCACTAACGAGATTCCACCTATTGGTCAATTTGTCGGACCACCC
TTCGCGGGTGCGCTCGTAGCACAACTTGGAGGGAGGTCTTTGAATTTCGTTGGTGTGGACTATGCTGCCGTCGTA
GGTGGCTTCCTGGTGGGGGGTGATCCGCAAGGTGCTCGCAACATGGCTAGTGATGTTACCTCATTTGCAAATGCA
TGCCCGGATACCGCTATCGTCATGTCTGGCTATAGGTTTGTCATTAGTATTTTTTACTTGAGTTACCCTGATAGG
CTGGGATATACAGTCAAGGGGCCCAACTTGTGCACCTTTCCGCAAACCAGATTTCTTCTTCCGTTCAGGAAAAGG
TGAAGGCCGTCGTGGTTTTCGGTGATCCAGATAATGGCGACGGCTTCCCTGGTGTATTGAATAGTCGCTCGATTA
CTTTTTGTGCAATTGGTGACACTATTTGTGATGGAGGCATCATTGTCTTTCCACCTCATTTTACCTATGGCCTGG
TAGGTTATTGATGATGGACGTTACACTGGCACTTGGGTCTGACTTATCCTGTTAGAATGTCGGAGAAGCAGCCGC
TTTCGTGGTTTCTCATCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail