Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|053480
Gene name
Locationscaffold_3:219498..223491
Strand+
Gene length (bp)3993
Transcript length (bp)3423
Coding sequence length (bp)3423
Protein length (aa) 1141

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12451 VPS11_C Vacuolar protein sorting protein 11 C terminal 7.6E-09 1089 1131
PF17122 zf-C3H2C3 Zinc-finger 2.8E-08 1050 1085

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 27 684 3.0E-123
sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 27 684 1.0E-122
sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 27 619 4.0E-109
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 53 619 4.0E-90
sp|P12868|PEP5_YEAST E3 ubiquitin-protein ligase PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP5 PE=1 SV=2 26 1108 4.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 27 684 3.0E-123
sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 27 684 1.0E-122
sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 27 619 4.0E-109
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 53 619 4.0E-90
sp|P12868|PEP5_YEAST E3 ubiquitin-protein ligase PEP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP5 PE=1 SV=2 26 1108 4.0E-52
sp|Q54YP4|VPS11_DICDI Vacuolar protein sorting-associated protein 11 homolog OS=Dictyostelium discoideum GN=vps11 PE=3 SV=1 813 1131 7.0E-43
sp|Q9P6N4|PEP5_SCHPO E3 ubiquitin-protein ligase pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps11 PE=3 SV=1 27 1082 2.0E-40
sp|Q09600|VPS11_CAEEL Vacuolar protein sorting-associated protein 11 homolog OS=Caenorhabditis elegans GN=vps-11 PE=3 SV=2 26 603 8.0E-39
sp|Q91W86|VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus GN=Vps11 PE=1 SV=3 824 1131 4.0E-38
sp|Q9SJ40|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana GN=VPS11 PE=1 SV=1 817 1134 4.0E-38
sp|Q9H270|VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens GN=VPS11 PE=1 SV=1 824 1131 6.0E-38
sp|Q8I480|ZNRF2_PLAF7 RING finger protein PFE0100w OS=Plasmodium falciparum (isolate 3D7) GN=PFE0100w PE=3 SV=1 380 614 5.0E-19
sp|Q09600|VPS11_CAEEL Vacuolar protein sorting-associated protein 11 homolog OS=Caenorhabditis elegans GN=vps-11 PE=3 SV=2 936 1131 1.0E-14
sp|P87295|PEP5L_SCHPO Pep5-like zinc finger protein C16A10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.03c PE=3 SV=2 27 504 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|053480
MPSSLTTLAVNATSKVSDSAGTAGPAWRQFPFFDVVPVKDVHDLESSPDIFKATPEISTVISSTSGVLVADIHGS
IHLLNRDFESVKSWVAHIDGRVTHMVEQKDILVTLGEEDAIRSPVLKIWDMHSFDGKMGAPLLLRSTRIQLGNRP
HPVTTVALSASLSHLAIGLGDGTVILYRHLDQSLASSPSLTNLPKIRTVHESPTEPITGLGFREPTDEIPSLYLF
IITTNRVLCYQASGKGSGSAPRVVDEIGTGLGCACIDWRGRDVIIARDEAIYACNTDGRGNCWAYEGRKSSIHTH
LSYLVIVSPPFIPSASSASATVRNFVARSTNTQETDITKVTVFDSENKIVAYTGPVRQGVRAVVSQWGNIYVLTS
DGQLLCLQEKSTADKLDMLYRKTHFPLALNVAMTQNLDDSSVADIHRQYGDHLYMKGDYDGAMQQFVQTIGFLQP
SYVIRKFLDAQRIHNLVTYLQELHTLGLASSDHTTLLLNTYTKLKDVARLDTFIKTESKRSSTTANGSGGGGGVK
SGTGDELPFDLDTAIRVCRQAGYYEHAAYLAEKYERHEDYLRIMIEDAGEFRAAGAYLRKLGPEIAESNLARYGR
AMLHSLPEETTQLLIDLCTMTTGSLKSESLEEAVTPTTAKRQSTTNSATSTTAGGASYLSYLALNRGGQNQILDQ
TNTTQPPSPSTKTIHADGPFASGRSTPVAPATPTATTTKGGGSQRAQTPTTQPQTTQSPSTPQPQSQRTQAVAPV
RLPSPRVCFAHFVDHMEQFVVFLETVALRRYGQSLEEGGGGGQGFVIQSMRGSMSSSVETQQLVEEEDKEDQVAI
WNTLLELYLTLPSSVVEKEEEEEEEKRKKKKKEYEEKAMKVLRSQLPFDSMHALILCSTHGFIDGLVLLWEKLGM
YEDIIRFWIERFKSGKDDDASKRVVTCLMTYGGGVEEPRRQLYPIVLRFLTSTPELLSKHREDLKGILEHVEEEG
IMPPLGVVQLLARNGVASVGLVKEWLMMRIKVSQDEIENDKNLIRSYRLETTEKMKQVEELTDMQHPKVFHVTRC
AICKAQLDLPAVHFMCNHSYHQRCIQEQDVECPICAREHGVIREIRMNNERLADQHDVFIGEVEERGFEAVATAF
SRGMLNMPRGEEMMG*
Coding >AgabiH97|053480
ATGCCTTCCAGCCTCACAACACTGGCTGTTAACGCGACATCCAAGGTGTCAGACTCTGCTGGGACAGCCGGACCC
GCCTGGCGACAATTTCCGTTTTTCGACGTCGTCCCAGTCAAAGACGTTCATGACCTCGAGAGTTCTCCAGATATT
TTCAAGGCAACGCCAGAGATCTCTACAGTGATCTCGTCGACGTCTGGAGTTCTTGTTGCCGATATACATGGTAGC
ATTCACTTACTCAATCGAGATTTTGAGTCGGTCAAGAGCTGGGTTGCGCATATCGATGGACGAGTGACACATATG
GTTGAACAGAAGGATATCCTCGTAACGCTTGGCGAAGAAGATGCCATAAGGTCTCCTGTTCTCAAGATTTGGGAC
ATGCACAGTTTCGATGGGAAGATGGGTGCTCCTCTCCTTCTACGCTCGACCAGAATCCAACTAGGCAATAGACCA
CATCCCGTGACGACTGTCGCGCTTTCTGCTTCCCTGTCTCATCTTGCCATTGGTCTAGGCGATGGCACCGTTATT
CTCTACCGGCACCTTGATCAATCTCTAGCATCTTCCCCCTCCTTGACAAACCTCCCAAAAATCCGTACTGTACAT
GAATCTCCTACAGAACCCATCACAGGACTAGGGTTTCGTGAACCTACAGATGAAATCCCGAGCCTTTACCTTTTC
ATCATCACGACGAATCGTGTGCTGTGCTATCAGGCCTCTGGAAAGGGAAGTGGTAGTGCACCGCGTGTTGTTGAT
GAGATTGGTACTGGCCTTGGATGTGCGTGTATAGATTGGAGAGGAAGGGACGTGATTATTGCGAGAGATGAAGCG
ATTTACGCGTGTAATACTGATGGAAGAGGGAATTGTTGGGCTTATGAAGGCAGGAAGTCATCCATCCATACTCAC
TTGAGCTATCTCGTCATAGTTTCACCACCTTTCATTCCATCCGCATCTTCTGCATCTGCCACTGTCAGGAATTTT
GTCGCGCGTTCTACGAATACCCAAGAGACCGATATCACAAAAGTGACCGTGTTCGACTCGGAAAACAAGATTGTC
GCGTATACTGGTCCTGTTAGACAAGGTGTGAGGGCTGTGGTATCACAATGGGGAAACATCTACGTTTTAACTTCA
GACGGTCAATTGCTGTGTTTACAGGAAAAGAGTACAGCTGATAAATTGGATATGCTCTACCGCAAAACGCATTTT
CCTCTCGCGCTTAATGTTGCCATGACGCAAAATCTGGATGATTCGAGTGTTGCTGATATTCATCGGCAATATGGT
GATCATTTGTATATGAAGGGTGATTATGATGGTGCAATGCAACAATTTGTGCAGACTATTGGGTTTTTGCAGCCT
AGTTATGTGATACGCAAGTTCCTTGATGCTCAACGAATTCACAATCTCGTAACATACCTCCAAGAATTACATACT
CTCGGTCTCGCAAGTTCCGATCATACAACATTACTCCTGAACACCTATACGAAACTCAAAGACGTCGCACGTCTC
GACACTTTTATCAAAACGGAATCCAAACGCAGTAGCACCACAGCCAATGGCAGTGGTGGTGGTGGCGGCGTTAAA
TCCGGTACAGGAGATGAATTGCCTTTTGATTTGGATACCGCTATACGAGTGTGTAGACAGGCGGGGTATTATGAG
CATGCTGCGTATTTGGCGGAGAAGTATGAGAGGCATGAGGATTATTTGAGGATTATGATTGAGGACGCTGGAGAA
TTCAGAGCTGCTGGAGCTTATTTGAGGAAATTGGGACCTGAAATCGCGGAAAGCAATTTGGCTAGATATGGACGA
GCGATGTTGCATAGCTTGCCGGAAGAAACGACACAGCTACTTATTGATCTGTGTACGATGACGACTGGGTCGTTG
AAGAGCGAATCATTGGAAGAAGCTGTGACGCCTACTACGGCGAAGAGACAGTCGACGACTAATAGTGCTACATCA
ACTACCGCTGGTGGAGCTTCGTATTTATCGTATTTGGCTCTTAACAGAGGTGGTCAAAACCAAATTCTGGATCAA
ACTAATACCACTCAGCCTCCATCACCTTCTACTAAAACTATTCACGCGGATGGTCCTTTTGCGTCTGGGAGATCT
ACACCCGTAGCGCCTGCTACACCGACTGCTACGACAACCAAAGGAGGTGGGAGTCAACGCGCGCAAACTCCAACT
ACACAACCTCAGACGACTCAAAGTCCTTCAACTCCTCAACCACAGTCGCAGCGAACGCAAGCTGTGGCTCCTGTG
AGGTTACCCTCTCCTAGAGTGTGTTTTGCACATTTTGTGGATCATATGGAACAGTTTGTTGTGTTCTTGGAGACG
GTTGCGTTGAGGAGGTATGGGCAGAGTTTGGAGGAGGGTGGGGGAGGAGGACAGGGGTTTGTGATTCAAAGTATG
AGGGGGTCGATGAGTTCGTCGGTTGAGACGCAGCAGCTTGTGGAAGAGGAGGATAAGGAGGATCAAGTTGCGATC
TGGAATACGTTGTTGGAGTTGTATTTGACTCTACCTTCCTCTGTTGTCGAAAAAGAGGAGGAAGAGGAAGAGGAA
AAACGAAAGAAGAAGAAGAAGGAATATGAAGAAAAGGCGATGAAGGTTTTACGAAGTCAGTTGCCTTTTGATTCT
ATGCATGCGCTTATACTGTGTTCCACGCATGGATTTATCGATGGTCTCGTTTTGCTTTGGGAGAAACTGGGGATG
TATGAGGATATTATTCGGTTTTGGATTGAGAGGTTTAAATCTGGGAAGGATGATGATGCGTCAAAGAGGGTTGTG
ACATGTTTGATGACTTATGGTGGTGGTGTTGAGGAACCTCGACGGCAGTTGTATCCGATTGTGTTGAGGTTTTTG
ACTTCGACGCCGGAGTTGTTGAGTAAACATAGGGAAGATTTGAAAGGGATTTTGGAACATGTTGAGGAGGAGGGG
ATTATGCCACCGCTTGGGGTTGTGCAGTTGTTGGCTAGGAATGGTGTGGCTAGTGTTGGATTGGTGAAGGAATGG
TTGATGATGAGGATTAAGGTGTCGCAAGACGAGATTGAGAATGACAAGAATTTGATTAGGTCGTATAGATTGGAA
ACGACAGAGAAAATGAAGCAGGTAGAGGAATTGACGGATATGCAACATCCGAAAGTGTTTCATGTTACGAGATGC
GCGATATGTAAAGCGCAATTGGATCTACCTGCGGTACACTTTATGTGTAATCACAGCTATCATCAAAGATGCATA
CAGGAACAGGATGTGGAATGTCCGATTTGTGCGAGGGAACATGGGGTTATACGTGAAATCCGGATGAATAATGAG
AGGCTTGCGGATCAACATGATGTTTTTATTGGGGAAGTAGAGGAGAGAGGGTTTGAAGCTGTTGCTACGGCATTT
AGTCGGGGGATGCTGAATATGCCTCGTGGAGAGGAGATGATGGGATAG
Transcript >AgabiH97|053480
ATGCCTTCCAGCCTCACAACACTGGCTGTTAACGCGACATCCAAGGTGTCAGACTCTGCTGGGACAGCCGGACCC
GCCTGGCGACAATTTCCGTTTTTCGACGTCGTCCCAGTCAAAGACGTTCATGACCTCGAGAGTTCTCCAGATATT
TTCAAGGCAACGCCAGAGATCTCTACAGTGATCTCGTCGACGTCTGGAGTTCTTGTTGCCGATATACATGGTAGC
ATTCACTTACTCAATCGAGATTTTGAGTCGGTCAAGAGCTGGGTTGCGCATATCGATGGACGAGTGACACATATG
GTTGAACAGAAGGATATCCTCGTAACGCTTGGCGAAGAAGATGCCATAAGGTCTCCTGTTCTCAAGATTTGGGAC
ATGCACAGTTTCGATGGGAAGATGGGTGCTCCTCTCCTTCTACGCTCGACCAGAATCCAACTAGGCAATAGACCA
CATCCCGTGACGACTGTCGCGCTTTCTGCTTCCCTGTCTCATCTTGCCATTGGTCTAGGCGATGGCACCGTTATT
CTCTACCGGCACCTTGATCAATCTCTAGCATCTTCCCCCTCCTTGACAAACCTCCCAAAAATCCGTACTGTACAT
GAATCTCCTACAGAACCCATCACAGGACTAGGGTTTCGTGAACCTACAGATGAAATCCCGAGCCTTTACCTTTTC
ATCATCACGACGAATCGTGTGCTGTGCTATCAGGCCTCTGGAAAGGGAAGTGGTAGTGCACCGCGTGTTGTTGAT
GAGATTGGTACTGGCCTTGGATGTGCGTGTATAGATTGGAGAGGAAGGGACGTGATTATTGCGAGAGATGAAGCG
ATTTACGCGTGTAATACTGATGGAAGAGGGAATTGTTGGGCTTATGAAGGCAGGAAGTCATCCATCCATACTCAC
TTGAGCTATCTCGTCATAGTTTCACCACCTTTCATTCCATCCGCATCTTCTGCATCTGCCACTGTCAGGAATTTT
GTCGCGCGTTCTACGAATACCCAAGAGACCGATATCACAAAAGTGACCGTGTTCGACTCGGAAAACAAGATTGTC
GCGTATACTGGTCCTGTTAGACAAGGTGTGAGGGCTGTGGTATCACAATGGGGAAACATCTACGTTTTAACTTCA
GACGGTCAATTGCTGTGTTTACAGGAAAAGAGTACAGCTGATAAATTGGATATGCTCTACCGCAAAACGCATTTT
CCTCTCGCGCTTAATGTTGCCATGACGCAAAATCTGGATGATTCGAGTGTTGCTGATATTCATCGGCAATATGGT
GATCATTTGTATATGAAGGGTGATTATGATGGTGCAATGCAACAATTTGTGCAGACTATTGGGTTTTTGCAGCCT
AGTTATGTGATACGCAAGTTCCTTGATGCTCAACGAATTCACAATCTCGTAACATACCTCCAAGAATTACATACT
CTCGGTCTCGCAAGTTCCGATCATACAACATTACTCCTGAACACCTATACGAAACTCAAAGACGTCGCACGTCTC
GACACTTTTATCAAAACGGAATCCAAACGCAGTAGCACCACAGCCAATGGCAGTGGTGGTGGTGGCGGCGTTAAA
TCCGGTACAGGAGATGAATTGCCTTTTGATTTGGATACCGCTATACGAGTGTGTAGACAGGCGGGGTATTATGAG
CATGCTGCGTATTTGGCGGAGAAGTATGAGAGGCATGAGGATTATTTGAGGATTATGATTGAGGACGCTGGAGAA
TTCAGAGCTGCTGGAGCTTATTTGAGGAAATTGGGACCTGAAATCGCGGAAAGCAATTTGGCTAGATATGGACGA
GCGATGTTGCATAGCTTGCCGGAAGAAACGACACAGCTACTTATTGATCTGTGTACGATGACGACTGGGTCGTTG
AAGAGCGAATCATTGGAAGAAGCTGTGACGCCTACTACGGCGAAGAGACAGTCGACGACTAATAGTGCTACATCA
ACTACCGCTGGTGGAGCTTCGTATTTATCGTATTTGGCTCTTAACAGAGGTGGTCAAAACCAAATTCTGGATCAA
ACTAATACCACTCAGCCTCCATCACCTTCTACTAAAACTATTCACGCGGATGGTCCTTTTGCGTCTGGGAGATCT
ACACCCGTAGCGCCTGCTACACCGACTGCTACGACAACCAAAGGAGGTGGGAGTCAACGCGCGCAAACTCCAACT
ACACAACCTCAGACGACTCAAAGTCCTTCAACTCCTCAACCACAGTCGCAGCGAACGCAAGCTGTGGCTCCTGTG
AGGTTACCCTCTCCTAGAGTGTGTTTTGCACATTTTGTGGATCATATGGAACAGTTTGTTGTGTTCTTGGAGACG
GTTGCGTTGAGGAGGTATGGGCAGAGTTTGGAGGAGGGTGGGGGAGGAGGACAGGGGTTTGTGATTCAAAGTATG
AGGGGGTCGATGAGTTCGTCGGTTGAGACGCAGCAGCTTGTGGAAGAGGAGGATAAGGAGGATCAAGTTGCGATC
TGGAATACGTTGTTGGAGTTGTATTTGACTCTACCTTCCTCTGTTGTCGAAAAAGAGGAGGAAGAGGAAGAGGAA
AAACGAAAGAAGAAGAAGAAGGAATATGAAGAAAAGGCGATGAAGGTTTTACGAAGTCAGTTGCCTTTTGATTCT
ATGCATGCGCTTATACTGTGTTCCACGCATGGATTTATCGATGGTCTCGTTTTGCTTTGGGAGAAACTGGGGATG
TATGAGGATATTATTCGGTTTTGGATTGAGAGGTTTAAATCTGGGAAGGATGATGATGCGTCAAAGAGGGTTGTG
ACATGTTTGATGACTTATGGTGGTGGTGTTGAGGAACCTCGACGGCAGTTGTATCCGATTGTGTTGAGGTTTTTG
ACTTCGACGCCGGAGTTGTTGAGTAAACATAGGGAAGATTTGAAAGGGATTTTGGAACATGTTGAGGAGGAGGGG
ATTATGCCACCGCTTGGGGTTGTGCAGTTGTTGGCTAGGAATGGTGTGGCTAGTGTTGGATTGGTGAAGGAATGG
TTGATGATGAGGATTAAGGTGTCGCAAGACGAGATTGAGAATGACAAGAATTTGATTAGGTCGTATAGATTGGAA
ACGACAGAGAAAATGAAGCAGGTAGAGGAATTGACGGATATGCAACATCCGAAAGTGTTTCATGTTACGAGATGC
GCGATATGTAAAGCGCAATTGGATCTACCTGCGGTACACTTTATGTGTAATCACAGCTATCATCAAAGATGCATA
CAGGAACAGGATGTGGAATGTCCGATTTGTGCGAGGGAACATGGGGTTATACGTGAAATCCGGATGAATAATGAG
AGGCTTGCGGATCAACATGATGTTTTTATTGGGGAAGTAGAGGAGAGAGGGTTTGAAGCTGTTGCTACGGCATTT
AGTCGGGGGATGCTGAATATGCCTCGTGGAGAGGAGATGATGGGATAG
Gene >AgabiH97|053480
ATGCCTTCCAGCCTCACAACACTGGCTGTTAACGCGACATCCAAGGTGTCAGACTCTGCTGGGACAGCCGGACCC
GCCGTAAGTATCGTTGAACGTATGTACACGCGGAGTCTAGCATCCCACCCAAGCGTTGCTGGTCACTAATTCATT
GGTGTTCTAACAGTGGCGACAATTTCCGTTTTTCGACGTCGTCCCAGTCAAAGACGTTCATGACCTCGAGAGTTC
TCCAGATATTTTCAAGGTGCGAGAGCCGTTCTACGTCTCCAGATATGGTTGCTCAGCTCGAACCTGTACAGGCAA
CGCCAGAGATCTCTACAGTGATCTCGTCGACGTCTGGAGTTCTTGTTGCCGATATACATGGTAGCATTCACTTAC
TCAATCGAGATTTTGAGTCGGTCAAGAGCTGGGTTGCGCATATCGATGGACGAGTGACACATATGGTTGAACAGA
AGGATATCCTCGTAACGCTTGGCGTACGTGTTCCATATTGCAAACCTAACTTGTTCTAACGACAATCTGTAGGAA
GAAGATGCCATAAGGTCTCCTGTTCTCAAGATTTGGGACATGCACAGTTTCGATGGGAAGATGGGTGCTCCTCTC
CTTCTACGCTCGACCAGAATCCAACTAGGCAATAGACCACATCCCGTAAGCACAGTAAACTCCTCTATGATCCGC
GTTTTTGCTGACATCCGCTCTACAGGTGACGACTGTCGCGCTTTCTGCTTCCCTGTCTCATCTTGCCATTGGTCT
AGGCGATGGCACCGTTATTCTCTACCGGCACCTTGATCAATCTCTAGCATCTTCCCCCTCCTTGACAAACCTCCC
AAAAATCCGTACTGTACATGAATCTCCTACAGAACCCATCACAGGACTAGGGTTTCGTGAACCTACAGATGAAAT
CCCGAGCCTTTACCTTTTCATCATCACGACGAATCGTGTGCTGTGCTATCAGGCCTCTGGAAAGGGAAGTGGTAG
TGCACCGCGTGTTGTTGATGAGATTGGTACTGGCCTTGGATGTGCGTGTATAGATTGGAGAGGAAGGGACGTGAT
TATTGCGAGAGATGAAGCGATTTACGCGTGTAATACTGATGGAAGAGGGAATTGTTGGGCTTATGAAGGTATGAG
GTGTCCATTGGCGCAAGAAACTTGTCTGATATCCTCTGTCTAGGCAGGAAGTCATCCATCCATACTCACTTGAGC
TATCTCGTCATAGTTTCACCACCTTTCATTCCATCCGCATCTTCTGCATCTGCCACTGTCAGGAATTTTGTCGCG
CGTTCTACGAATACCCAAGAGACCGATATCACAAAAGTGACCGTGTTCGACTCGGAAAACAAGATTGTCGCGTAT
ACTGGTCCTGTTAGACAAGGTGTGAGGGCTGTGGTATCACAATGGGGAAACATCTACGTTTTAACTTCAGACGGT
CAAGTACGCCCGAAAACAAAACAAAAACGCGTGAACTGACACGTTTTTTTTTTGGTAGTTGCTGTGTTTACAGGA
AAAGAGTACAGCTGATAAATTGGATATGCTCTACCGCAAAACGCATTTTCCTCTCGCGCTTAATGTTGCCATGAC
GCAAAATCTGGATGATTCGAGTGTTGCTGATATTCATCGGCAATATGGTGATCATTTGTATATGAAGGGTGATTA
TGATGGTGCAATGCAACAATTTGTGCAGACTATTGGGTTTTTGCAGCCTAGTTATGTGATACGCAAGGTAACTCA
TTTCTTCTTCTCCCTTTGTTTGTAGTGCTTATGCGTTGATATAGTTCCTTGATGCTCAACGAATTCACAATCTCG
TAACATACCTCCAAGAATTACATACTCTCGGTCTCGCAAGTTCCGATCATACAACATTACTCCTGAACACCTATA
CGAAACTCAAAGACGTCGCACGTCTCGACACTTTTATCAAAACGGAATCCAAACGCAGTAGCACCACAGCCAATG
GCAGTGGTGGTGGTGGCGGCGTTAAATCCGGTACAGGAGATGAATTGCCTTTTGATTTGGATACCGCTATACGAG
TGTGTAGACAGGCGGGGTATTATGAGCATGCTGCGTATTTGGCGGAGAAGTATGAGAGGCATGAGGATTATTTGA
GGATTATGATTGAGGACGCTGGAGAATTCAGAGCTGCTGGAGCTTATTTGAGGAAATTGGGACCTGAAATCGTAG
GCGTTTCTTCTCTCTGTTTTTTTTCCATTGACTAAGTGATGTGATAGGCGGAAAGCAATTTGGCTAGATATGGAC
GAGCGATGTTGCATAGCTTGCCGGAAGAAACGACACAGCTACTTATTGATCTGTGTACGATGACGACTGGGTCGT
TGAAGAGCGAATCATTGGAAGAAGCTGTGACGCCTACTACGGCGAAGAGACAGTCGACGACTAATAGTGCTACAT
CAACTACCGCTGGTGGAGCTTCGTATTTATCGTATTTGGCTCTTAACAGAGGTGGTCAAAACCAAATTCTGGATC
AAACTAATACCACTCAGCCTCCATCACCTTCTACTAAAACTATTCACGCGGATGGTCCTTTTGCGTCTGGGAGAT
CTACACCCGTAGCGCCTGCTACACCGACTGCTACGACAACCAAAGGAGGTGGGAGTCAACGCGCGCAAACTCCAA
CTACACAACCTCAGACGACTCAAAGTCCTTCAACTCCTCAACCACAGTCGCAGCGAACGCAAGCTGTGGCTCCTG
TGAGGTTACCCTCTCCTAGAGTGTGTTTTGCACATTTTGTGGATCATATGGAACAGTTTGTTGTGTTCTTGGAGA
CGGTTGCGTTGAGGAGGTATGGGCAGAGTTTGGAGGAGGGTGGGGGAGGAGGACAGGGGTTTGTGATTCAAAGTA
TGAGGGGGTCGATGAGTTCGTCGGTTGAGACGCAGCAGCTTGTGGAAGAGGAGGATAAGGAGGATCAAGTTGCGA
TCTGGAATACGTTGTTGGAGTTGTATTTGACTCTACCTTCCTCTGTTGTCGAAAAAGAGGAGGAAGAGGAAGAGG
AAAAACGAAAGAAGAAGAAGAAGGAATATGAAGAAAAGGCGATGAAGGTTTTACGAAGTCAGTTGCCTTTTGATT
CTATGCATGCGCTTATACTGTGTTCCACGCATGGATTTATCGATGGTCTCGTTTTGCTTTGGGAGAAACTGGGGA
TGTATGAGGATATTATTCGGTTTTGGATTGAGAGGTTTAAATCTGGGAAGGATGATGATGCGTCAAAGAGGGTTG
TGACATGTTTGATGACTTATGGTGGTGGTGTTGAGGAACCTCGACGGCAGTTGTATCCGATTGTGTTGAGGTTTT
TGACTTCGACGCCGGAGTTGTTGAGTAAACATAGGGAAGATTTGAAAGGGATTTTGGAACATGTTGAGGAGGAGG
GGATTATGCCACCGCTTGGGGTTGTGCAGTTGTTGGCTAGGAATGGTGTGGCTAGTGTTGGATTGGTGAAGGAAT
GGTTGATGATGAGGATTAAGGTGTCGCAAGACGAGATTGAGAATGTAAGCTTTCGATTTTTTTTTCCCTGAGGTT
ATGCTGTTTTGTTGATTTTTCTTTTTCAAGGACAAGAATTTGATTAGGTCGTATAGATTGGAAACGACAGAGAAA
ATGAAGCAGGTAGAGGAATTGACGGATATGCAACATCCGAAAGTGTTTCATGTTACGAGATGCGCGATATGTAAA
GCGCAATTGGATCTACCTGCGGTACACTTTATGTGTAATCACAGCTATCATCAAAGGTTCGTCAAAATTGAAATA
ATTTATGGTTTTTTGTTTCTCAAATCCGACTTTTTTAGATGCATACAGGAACAGGATGTGGAATGTCCGATTTGT
GCGAGGGAACATGGGGTTATACGTGAAATCCGGATGAATAATGAGAGGCTTGCGGATCAACATGATGTTTTTATT
GGGGAAGTAGAGGAGAGAGGGTTTGAAGCTGTTGCTACGGCATTTAGTCGGGGGATGCTGAATATGCCTCGTGGA
GAGGAGATGATGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail