Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|053200
Gene name
Locationscaffold_3:141946..143594
Strand-
Gene length (bp)1648
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 3.1E-11 68 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O23487|BH003_ARATH Transcription factor bHLH3 OS=Arabidopsis thaliana GN=BHLH3 PE=2 SV=1 2 146 9.0E-07
sp|Q39204|MYC2_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=MYC2 PE=1 SV=2 55 144 3.0E-06
sp|P22415|USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens GN=USF1 PE=1 SV=1 50 169 3.0E-06
sp|Q6XBT4|USF1_BOVIN Upstream stimulatory factor 1 OS=Bos taurus GN=USF1 PE=2 SV=1 50 157 3.0E-06
sp|O02818|USF1_RABIT Upstream stimulatory factor 1 OS=Oryctolagus cuniculus GN=USF1 PE=2 SV=1 50 172 6.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O23487|BH003_ARATH Transcription factor bHLH3 OS=Arabidopsis thaliana GN=BHLH3 PE=2 SV=1 2 146 9.0E-07
sp|Q39204|MYC2_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=MYC2 PE=1 SV=2 55 144 3.0E-06
sp|P22415|USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens GN=USF1 PE=1 SV=1 50 169 3.0E-06
sp|Q6XBT4|USF1_BOVIN Upstream stimulatory factor 1 OS=Bos taurus GN=USF1 PE=2 SV=1 50 157 3.0E-06
sp|O02818|USF1_RABIT Upstream stimulatory factor 1 OS=Oryctolagus cuniculus GN=USF1 PE=2 SV=1 50 172 6.0E-06
sp|Q61069|USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus GN=Usf1 PE=1 SV=1 50 172 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.605 0.8878 0.0225 0.0268 0.2783 0.0005 0.0602 0.1117 0.0666 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1495
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|279700
Agaricus bisporus var bisporus H97 AgabiH97|053200 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|37_23

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|053200
MALTLPPSPASGNSSGSDAEAPHTPSTPNSQQESNTQQQNSQSANPSSPTNPSQVKRKPSRRANTAERRATHNAV
ERQRRETLNGRFLDLAALLPNLSQIRRPSKSSIVNSSIAHIHASRRHRFLAARELRMLKHEADALRREVNEWRDR
SAIPRVEEPVRSEAFTMVLSGELEVIAAVLGEEDGEEDNDYAGYEDEYSNVAPSHGIARVHSHHANSLSPMEEMD
DPRVTSMMKTGHGFAHNIPSGPAGNGLPLAHILPRPSANASMISSPTSFEGPNMYDTPHGFGGTPTGAGFMQQSQ
QSMEAEKMAAWYGAQSQQQMMAQQRSLYTPPATSHGSNGNNGNGSNGSVSPINGNPASHGGSKPPSPASTNPFSD
PSQAFFAANMSRQQGYSSDDGSAGSNGSNGKRLSIPVPIPINVTGRGRALSTASHSAHSVGMSSPGNSPVSTGCG
SPTYDVDNQSFNRRPGPNGWRDEIPIAQQHGHGLMGIMGNGMMMNGMGMGLNNGLVGNAMGTMVPVGGGGNGGGF
AMMM*
Coding >AgabiH97|053200
ATGGCCTTGACACTCCCACCCTCCCCTGCTTCGGGCAATTCCTCCGGCTCGGATGCAGAAGCACCCCACACCCCC
TCTACTCCTAACTCCCAGCAGGAAAGCAACACACAGCAGCAGAATAGCCAATCGGCCAATCCTTCTTCACCTACG
AATCCTTCTCAAGTCAAGCGCAAGCCCAGCAGGCGAGCCAACACTGCCGAGCGCCGCGCAACTCACAATGCAGTC
GAACGCCAGCGTAGAGAGACTCTGAATGGTCGTTTTCTTGATCTCGCGGCCCTCTTACCCAATCTCTCGCAGATT
CGTCGTCCTTCTAAATCCTCTATCGTCAATTCGTCAATCGCGCATATACATGCTTCTCGGCGTCATCGTTTCCTT
GCTGCCCGCGAGCTTCGCATGTTGAAACATGAAGCTGATGCCCTTCGTCGTGAGGTCAATGAATGGCGTGATCGT
TCCGCAATCCCTCGCGTCGAAGAACCCGTTCGAAGCGAGGCCTTTACTATGGTCCTTAGCGGCGAGCTCGAAGTC
ATTGCTGCCGTGCTTGGAGAAGAAGATGGCGAAGAAGACAACGACTATGCAGGCTATGAGGATGAGTACTCGAAC
GTGGCTCCAAGCCATGGGATTGCCCGTGTTCACTCGCACCATGCTAATTCTCTTTCTCCGATGGAAGAGATGGAT
GATCCTCGTGTAACTTCGATGATGAAAACTGGACATGGTTTCGCTCATAACATCCCTTCTGGTCCTGCCGGCAAT
GGCCTGCCTCTTGCTCACATTCTTCCCCGCCCCTCTGCGAATGCATCCATGATTTCCAGCCCTACTTCTTTTGAG
GGCCCTAACATGTACGATACCCCTCACGGTTTTGGCGGTACTCCTACTGGTGCTGGATTCATGCAACAGTCTCAG
CAGTCCATGGAAGCGGAAAAGATGGCCGCGTGGTACGGAGCACAGTCACAGCAACAAATGATGGCTCAACAGAGG
TCTCTTTACACTCCTCCTGCGACGTCTCATGGTTCAAACGGTAATAATGGCAACGGCAGCAACGGTAGTGTCTCG
CCTATCAATGGTAACCCTGCTTCACATGGTGGATCCAAACCCCCTTCTCCCGCCTCCACCAACCCTTTCTCTGAC
CCTTCGCAAGCATTCTTCGCAGCGAATATGTCTCGACAGCAAGGTTATTCCAGCGATGATGGAAGTGCTGGAAGT
AATGGATCGAATGGAAAACGCTTGTCTATTCCTGTACCCATCCCTATCAATGTCACGGGTCGAGGACGAGCGTTG
AGCACAGCTAGCCATAGTGCCCATAGCGTGGGTATGAGTAGCCCGGGCAATTCGCCTGTCAGCACTGGTTGCGGC
AGCCCGACGTACGACGTTGACAATCAATCTTTCAATCGTCGACCCGGGCCTAATGGGTGGAGGGACGAGATCCCC
ATAGCACAGCAGCATGGCCACGGTCTCATGGGAATCATGGGTAACGGTATGATGATGAACGGAATGGGAATGGGA
CTGAACAACGGTTTAGTTGGGAACGCAATGGGGACCATGGTCCCAGTTGGTGGTGGAGGGAATGGGGGAGGATTT
GCAATGATGATGTGA
Transcript >AgabiH97|053200
ATGGCCTTGACACTCCCACCCTCCCCTGCTTCGGGCAATTCCTCCGGCTCGGATGCAGAAGCACCCCACACCCCC
TCTACTCCTAACTCCCAGCAGGAAAGCAACACACAGCAGCAGAATAGCCAATCGGCCAATCCTTCTTCACCTACG
AATCCTTCTCAAGTCAAGCGCAAGCCCAGCAGGCGAGCCAACACTGCCGAGCGCCGCGCAACTCACAATGCAGTC
GAACGCCAGCGTAGAGAGACTCTGAATGGTCGTTTTCTTGATCTCGCGGCCCTCTTACCCAATCTCTCGCAGATT
CGTCGTCCTTCTAAATCCTCTATCGTCAATTCGTCAATCGCGCATATACATGCTTCTCGGCGTCATCGTTTCCTT
GCTGCCCGCGAGCTTCGCATGTTGAAACATGAAGCTGATGCCCTTCGTCGTGAGGTCAATGAATGGCGTGATCGT
TCCGCAATCCCTCGCGTCGAAGAACCCGTTCGAAGCGAGGCCTTTACTATGGTCCTTAGCGGCGAGCTCGAAGTC
ATTGCTGCCGTGCTTGGAGAAGAAGATGGCGAAGAAGACAACGACTATGCAGGCTATGAGGATGAGTACTCGAAC
GTGGCTCCAAGCCATGGGATTGCCCGTGTTCACTCGCACCATGCTAATTCTCTTTCTCCGATGGAAGAGATGGAT
GATCCTCGTGTAACTTCGATGATGAAAACTGGACATGGTTTCGCTCATAACATCCCTTCTGGTCCTGCCGGCAAT
GGCCTGCCTCTTGCTCACATTCTTCCCCGCCCCTCTGCGAATGCATCCATGATTTCCAGCCCTACTTCTTTTGAG
GGCCCTAACATGTACGATACCCCTCACGGTTTTGGCGGTACTCCTACTGGTGCTGGATTCATGCAACAGTCTCAG
CAGTCCATGGAAGCGGAAAAGATGGCCGCGTGGTACGGAGCACAGTCACAGCAACAAATGATGGCTCAACAGAGG
TCTCTTTACACTCCTCCTGCGACGTCTCATGGTTCAAACGGTAATAATGGCAACGGCAGCAACGGTAGTGTCTCG
CCTATCAATGGTAACCCTGCTTCACATGGTGGATCCAAACCCCCTTCTCCCGCCTCCACCAACCCTTTCTCTGAC
CCTTCGCAAGCATTCTTCGCAGCGAATATGTCTCGACAGCAAGGTTATTCCAGCGATGATGGAAGTGCTGGAAGT
AATGGATCGAATGGAAAACGCTTGTCTATTCCTGTACCCATCCCTATCAATGTCACGGGTCGAGGACGAGCGTTG
AGCACAGCTAGCCATAGTGCCCATAGCGTGGGTATGAGTAGCCCGGGCAATTCGCCTGTCAGCACTGGTTGCGGC
AGCCCGACGTACGACGTTGACAATCAATCTTTCAATCGTCGACCCGGGCCTAATGGGTGGAGGGACGAGATCCCC
ATAGCACAGCAGCATGGCCACGGTCTCATGGGAATCATGGGTAACGGTATGATGATGAACGGAATGGGAATGGGA
CTGAACAACGGTTTAGTTGGGAACGCAATGGGGACCATGGTCCCAGTTGGTGGTGGAGGGAATGGGGGAGGATTT
GCAATGATGATGTGA
Gene >AgabiH97|053200
ATGGCCTTGACACTCCCACCCTCCCCTGCTTCGGGCAATTCCTCCGGCTCGGATGCAGAAGCACCCCACACCCCC
TCTACTCCTAACTCCCAGCAGGAAAGCAACACACAGCAGCAGAATAGCCAATCGGCCAATCCTTCTTCACCTACG
AATCCTTCTCAAGTCAAGCGCAAGCCCAGCAGGCGAGCCAACACTGCCGAGCGCCGCGCAACTCACAATGCAGTC
GAACGCCAGCGTAGAGAGACTCTGAATGGTCGTTTTCTTGTGGGTTAGCTTACTGTACTTTTAGGGCGCATATAC
TTACCCGTCGTCTTTAAATTAGGATCTCGCGGCCCTCTTACCCAATCTCTCGCAGATTCGTCGTCCTTCTAAATC
CTCTATCGTCAATTCGTCAATCGCGCATATACATGCTTCTCGGCGTCATCGTTTCCTTGCTGCCCGCGAGCTTCG
CATGTTGAAACATGAAGCTGATGCCCTTCGTCGTGAGGTCAATGAATGGCGTGATCGTTCCGCAATCCCTCGCGT
CGAAGAACCCGTTCGAAGCGAGGCCTTTACTATGGTCCTTAGCGGCGAGCTCGAAGTCATTGCTGCCGTGCTTGG
AGAAGAAGATGGCGAAGAAGACAACGACTATGCAGGCTATGAGGATGAGTACTCGAACGTGGCTCCAAGCCATGG
GATTGCCCGTGTTCACTCGCACCATGCTAATTCTCTTTCTCCGATGGAAGAGATGGATGATCCTCGTGTAACTTC
GATGATGAAAACTGGACATGGTTTCGCTCATAACATCCCTTCTGGTCCTGCCGGCAATGGCCTGCCTCTTGCTCA
CATTCTTCCCCGCCCCTCTGCGAATGCATCCATGATTTCCAGCCCTACTTCTTTTGAGGGCCCTAACATGTACGA
TACCCCTCACGGTTTTGGCGGTACTCCTACTGGTGCTGGATTCATGCAACAGTCTCAGCAGTCCATGGAAGCGGA
AAAGATGGCCGCGTGGTACGGAGCACAGTCACAGCAACAAATGATGGCTCAACAGAGGTCTCTTTACACTCCTCC
TGCGACGTCTCATGGTTCAAACGGTAATAATGGCAACGGCAGCAACGGTAGTGTCTCGCCTATCAATGGTAACCC
TGCTTCACATGGTGGATCCAAACCCCCTTCTCCCGCCTCCACCAACCCTTTCTCTGACCCTTCGCAAGCATTCTT
CGCAGCGAATATGTCTCGACAGCAAGGTTATTCCAGCGATGATGGAAGTGCTGGAAGTAATGGATCGAATGGAAA
ACGCTTGTCTATTCCTGTACCCATCCCTATCAATGTCACGGGTCGAGGACGAGCGTTGAGCACAGCTAGCCATAG
TGCCCATAGCGTGGGTATGAGTAGCCCGGGCAATTCGCCTGTCAGCACTGGTTGCGGCAGCCCGACGTACGACGT
TGACAATCAATCTTTCAATCGTCGACCCGGGCCTAATGGGTGGAGGGACGAGATCCCCATAGCACAGCAGCATGG
CCACGGTCTCATGGGAATCATGGGTAACGGTATGATGATGAACGGAATGGGAATGGGACTGAACAACGGTTTAGT
TGGGAACGCAATGGGGACCATGGTCCCAGTTGGTGGTGGAGGGAATGGGGGAGGATTTGCAATGATGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail