Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|053130
Gene name
Locationscaffold_3:127197..128178
Strand+
Gene length (bp)981
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 31.45 16.47 46.42
Initials Initials knots 19.14 9.38 28.90
Pileal_Stipeal_center Stage I stipe center 39.51 21.19 57.82
Pileal_Stipeal_shell Stage I stipe shell 46.36 25.52 67.20
DIF_stipe_center Stage II stipe center 41.12 22.27 59.96
DIF_stipe_shell Stage II stipe shell 33.34 17.65 49.04
DIF_stipe_skin Stage II stipe skin 37.68 20.22 55.13
DIF_cap_skin Stage II cap skin 54.10 30.16 78.04
DIF_cap_tissue Stage II cap tissue 55.76 31.50 80.02
DIF_gill_tissue Stage II gill tissue 49.72 27.69 71.76
YFB_stipe_center Young fruiting body stipe center 43.66 23.99 63.33
YFB_stipe_shell Young fruiting body stipe shell 35.67 18.94 52.39
YFB_stipe_skin Young fruiting body stipe skin 39.43 21.26 57.61
YFB_cap_skin Young fruiting body cap skin 47.62 26.20 69.04
YFB_cap_tissue Young fruiting body cap tissue 52.56 29.22 75.91
YFB_gill_tissue Young fruiting body gill tissue 38.76 20.95 56.57
YFB_veil Young fruiting body veil 46.87 25.52 68.23

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.163299 no
Casing YFB_stipe_center 0.389156 no
Casing YFB_stipe_shell 0.812897 no
Casing YFB_stipe_skin 0.602939 no
Casing YFB_cap_skin 0.227254 no
Casing YFB_cap_tissue 0.105702 no
Casing YFB_gill_tissue 0.653473 no
Casing YFB_veil 0.244055 no
Casing Initials 0.143206 no
Casing Pileal_Stipeal_center 0.605734 no
Casing Pileal_Stipeal_shell 0.273655 no
Casing DIF_stipe_center 0.514845 no
Casing DIF_stipe_shell 0.924724 no
Casing DIF_stipe_skin 0.706088 no
Casing DIF_cap_skin 0.084360 no
Casing DIF_cap_tissue 0.058347 no
DIF_gill_tissue YFB_stipe_center 0.795954 no
DIF_gill_tissue YFB_stipe_shell 0.376795 no
DIF_gill_tissue YFB_stipe_skin 0.576613 no
DIF_gill_tissue YFB_cap_skin 0.942449 no
DIF_gill_tissue YFB_cap_tissue 0.925332 no
DIF_gill_tissue YFB_gill_tissue 0.555161 no
DIF_gill_tissue YFB_veil 0.917222 no
YFB_stipe_center YFB_stipe_shell 0.656388 no
YFB_stipe_center YFB_stipe_skin 0.852491 no
YFB_stipe_center YFB_cap_skin 0.877953 no
YFB_stipe_center YFB_cap_tissue 0.681460 no
YFB_stipe_center YFB_gill_tissue 0.826192 no
YFB_stipe_center YFB_veil 0.901508 no
YFB_stipe_shell YFB_stipe_skin 0.858847 no
YFB_stipe_shell YFB_cap_skin 0.463878 no
YFB_stipe_shell YFB_cap_tissue 0.274252 no
YFB_stipe_shell YFB_gill_tissue 0.889096 no
YFB_stipe_shell YFB_veil 0.494241 no
YFB_stipe_skin YFB_cap_skin 0.671979 no
YFB_stipe_skin YFB_cap_tissue 0.454694 no
YFB_stipe_skin YFB_gill_tissue 0.978283 no
YFB_stipe_skin YFB_veil 0.700286 no
YFB_cap_skin YFB_cap_tissue 0.852009 no
YFB_cap_skin YFB_gill_tissue 0.646759 no
YFB_cap_skin YFB_veil 0.979211 no
YFB_cap_tissue YFB_gill_tissue 0.437303 no
YFB_cap_tissue YFB_veil 0.821989 no
YFB_gill_tissue YFB_veil 0.676607 no
Initials DIF_gill_tissue 0.002084 yes
Initials YFB_stipe_center 0.004928 yes
Initials YFB_stipe_shell 0.055779 no
Initials YFB_stipe_skin 0.022631 yes
Initials YFB_cap_skin 0.002525 yes
Initials YFB_cap_tissue 0.002084 yes
Initials YFB_gill_tissue 0.025458 yes
Initials YFB_veil 0.002525 yes
Initials Pileal_Stipeal_center 0.022892 yes
Initials Pileal_Stipeal_shell 0.003365 yes
Initials DIF_stipe_center 0.013782 yes
Initials DIF_stipe_shell 0.096624 no
Initials DIF_stipe_skin 0.031557 yes
Initials DIF_cap_skin 0.001625 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.594495 no
Pileal_Stipeal_center YFB_stipe_center 0.858905 no
Pileal_Stipeal_center YFB_stipe_shell 0.857821 no
Pileal_Stipeal_center YFB_stipe_skin 0.996972 no
Pileal_Stipeal_center YFB_cap_skin 0.687740 no
Pileal_Stipeal_center YFB_cap_tissue 0.474469 no
Pileal_Stipeal_center YFB_gill_tissue 0.976714 no
Pileal_Stipeal_center YFB_veil 0.716007 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.746488 no
Pileal_Stipeal_center DIF_stipe_center 0.949856 no
Pileal_Stipeal_center DIF_stipe_shell 0.733195 no
Pileal_Stipeal_center DIF_stipe_skin 0.940666 no
Pileal_Stipeal_center DIF_cap_skin 0.413116 no
Pileal_Stipeal_center DIF_cap_tissue 0.340458 no
Pileal_Stipeal_shell DIF_gill_tissue 0.904414 no
Pileal_Stipeal_shell YFB_stipe_center 0.921371 no
Pileal_Stipeal_shell YFB_stipe_shell 0.531678 no
Pileal_Stipeal_shell YFB_stipe_skin 0.733736 no
Pileal_Stipeal_shell YFB_cap_skin 0.965311 no
Pileal_Stipeal_shell YFB_cap_tissue 0.805146 no
Pileal_Stipeal_shell YFB_gill_tissue 0.705398 no
Pileal_Stipeal_shell YFB_veil 0.985052 no
Pileal_Stipeal_shell DIF_stipe_center 0.819055 no
Pileal_Stipeal_shell DIF_stipe_shell 0.386890 no
Pileal_Stipeal_shell DIF_stipe_skin 0.642259 no
Pileal_Stipeal_shell DIF_cap_skin 0.746161 no
Pileal_Stipeal_shell DIF_cap_tissue 0.670864 no
DIF_stipe_center DIF_gill_tissue 0.671034 no
DIF_stipe_center YFB_stipe_center 0.919948 no
DIF_stipe_center YFB_stipe_shell 0.779324 no
DIF_stipe_center YFB_stipe_skin 0.945387 no
DIF_stipe_center YFB_cap_skin 0.764664 no
DIF_stipe_center YFB_cap_tissue 0.548818 no
DIF_stipe_center YFB_gill_tissue 0.920362 no
DIF_stipe_center YFB_veil 0.789950 no
DIF_stipe_center DIF_stipe_shell 0.638874 no
DIF_stipe_center DIF_stipe_skin 0.876354 no
DIF_stipe_center DIF_cap_skin 0.488298 no
DIF_stipe_center DIF_cap_tissue 0.409695 no
DIF_stipe_shell DIF_gill_tissue 0.247691 no
DIF_stipe_shell YFB_stipe_center 0.510598 no
DIF_stipe_shell YFB_stipe_shell 0.913393 no
DIF_stipe_shell YFB_stipe_skin 0.731908 no
DIF_stipe_shell YFB_cap_skin 0.328526 no
DIF_stipe_shell YFB_cap_tissue 0.171800 no
DIF_stipe_shell YFB_gill_tissue 0.772909 no
DIF_stipe_shell YFB_veil 0.349479 no
DIF_stipe_shell DIF_stipe_skin 0.820836 no
DIF_stipe_shell DIF_cap_skin 0.139267 no
DIF_stipe_shell DIF_cap_tissue 0.103956 no
DIF_stipe_skin DIF_gill_tissue 0.491424 no
DIF_stipe_skin YFB_stipe_center 0.772722 no
DIF_stipe_skin YFB_stipe_shell 0.929931 no
DIF_stipe_skin YFB_stipe_skin 0.942876 no
DIF_stipe_skin YFB_cap_skin 0.586018 no
DIF_stipe_skin YFB_cap_tissue 0.378960 no
DIF_stipe_skin YFB_gill_tissue 0.963923 no
DIF_stipe_skin YFB_veil 0.616341 no
DIF_stipe_skin DIF_cap_skin 0.324693 no
DIF_stipe_skin DIF_cap_tissue 0.257674 no
DIF_cap_skin DIF_gill_tissue 0.878566 no
DIF_cap_skin YFB_stipe_center 0.616840 no
DIF_cap_skin YFB_stipe_shell 0.229147 no
DIF_cap_skin YFB_stipe_skin 0.393887 no
DIF_cap_skin YFB_cap_skin 0.801138 no
DIF_cap_skin YFB_cap_tissue 0.963883 no
DIF_cap_skin YFB_gill_tissue 0.378882 no
DIF_cap_skin YFB_veil 0.764225 no
DIF_cap_skin DIF_cap_tissue 0.960101 no
DIF_cap_tissue DIF_gill_tissue 0.820908 no
DIF_cap_tissue YFB_stipe_center 0.538457 no
DIF_cap_tissue YFB_stipe_shell 0.177942 no
DIF_cap_tissue YFB_stipe_skin 0.325695 no
DIF_cap_tissue YFB_cap_skin 0.732128 no
DIF_cap_tissue YFB_cap_tissue 0.919193 no
DIF_cap_tissue YFB_gill_tissue 0.310296 no
DIF_cap_tissue YFB_veil 0.690658 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|053130
MLRHLSLNLSLRTLGLLQDVLQLCPLLETLDINDIDYVDAEYVQYPLPSSHSCVPRIVNYHGPANLASKVLAACP
FKNLSLHTGKSKENTYGQCEIQRLLRPLAHHSPAHIGLSVVYPDPKLCDTLSTIFSDITSLHICYNDPEPLTTVN
DGSHYRQIVVIDDRYSFMWQIRPRTTMMGILDRLVTRESSLPQGLVKLRFTQADPYSSRQITRKEQQEYLDRLLY
SYKDLMFFQLDVLHIGHNLTIPTINYCVCWRPASIKERAQH*
Coding >AgabiH97|053130
ATGCTGAGACATCTATCCTTGAACCTCAGCCTTCGTACACTTGGGCTTCTGCAGGATGTACTTCAACTGTGTCCA
TTACTGGAGACTCTCGATATCAACGACATCGACTACGTTGACGCTGAATACGTTCAATACCCGCTCCCTTCATCG
CACTCCTGCGTTCCACGCATTGTGAACTATCACGGCCCAGCCAACCTCGCATCCAAAGTGCTCGCTGCATGCCCC
TTCAAAAATCTCTCCCTCCATACTGGCAAATCTAAAGAGAATACATATGGCCAATGCGAAATACAAAGGCTCCTG
AGACCCCTCGCTCACCATAGTCCTGCTCATATAGGTCTCAGTGTTGTCTATCCTGATCCCAAATTATGTGATACC
CTTTCTACGATCTTTTCCGACATCACATCCCTTCATATATGTTATAACGACCCTGAACCTCTTACAACCGTGAAC
GACGGAAGTCACTATCGACAAATTGTCGTTATAGATGACCGTTATTCTTTTATGTGGCAAATTAGACCGCGAACG
ACAATGATGGGGATATTAGATCGTCTCGTAACTCGCGAGTCTTCACTCCCGCAAGGCCTTGTCAAATTACGTTTC
ACCCAAGCAGACCCATATAGCTCTCGTCAGATTACACGGAAAGAACAACAGGAATATCTGGATAGGCTCCTTTAC
TCATATAAAGATTTGATGTTCTTCCAGCTTGATGTACTTCATATCGGGCATAATCTGACGATACCCACGATCAAT
TACTGTGTCTGTTGGAGACCAGCCTCCATCAAAGAACGAGCACAACATTAA
Transcript >AgabiH97|053130
ATGCTGAGACATCTATCCTTGAACCTCAGCCTTCGTACACTTGGGCTTCTGCAGGATGTACTTCAACTGTGTCCA
TTACTGGAGACTCTCGATATCAACGACATCGACTACGTTGACGCTGAATACGTTCAATACCCGCTCCCTTCATCG
CACTCCTGCGTTCCACGCATTGTGAACTATCACGGCCCAGCCAACCTCGCATCCAAAGTGCTCGCTGCATGCCCC
TTCAAAAATCTCTCCCTCCATACTGGCAAATCTAAAGAGAATACATATGGCCAATGCGAAATACAAAGGCTCCTG
AGACCCCTCGCTCACCATAGTCCTGCTCATATAGGTCTCAGTGTTGTCTATCCTGATCCCAAATTATGTGATACC
CTTTCTACGATCTTTTCCGACATCACATCCCTTCATATATGTTATAACGACCCTGAACCTCTTACAACCGTGAAC
GACGGAAGTCACTATCGACAAATTGTCGTTATAGATGACCGTTATTCTTTTATGTGGCAAATTAGACCGCGAACG
ACAATGATGGGGATATTAGATCGTCTCGTAACTCGCGAGTCTTCACTCCCGCAAGGCCTTGTCAAATTACGTTTC
ACCCAAGCAGACCCATATAGCTCTCGTCAGATTACACGGAAAGAACAACAGGAATATCTGGATAGGCTCCTTTAC
TCATATAAAGATTTGATGTTCTTCCAGCTTGATGTACTTCATATCGGGCATAATCTGACGATACCCACGATCAAT
TACTGTGTCTGTTGGAGACCAGCCTCCATCAAAGAACGAGCACAACATTAA
Gene >AgabiH97|053130
ATGCTGAGACATCTATCCTTGAACCTCAGCCTTCGTACACTTGGGCTTCTGCAGGATGTACTTCAACTGTGTCCA
TTACTGGAGACTCTCGATATCAACGACATCGACTACGTTGACGCTGAATACGTTCAATACCCGCTCCCTTCATCG
CACTCCTGCGTTCCACGCATTGTGAACTATCACGGCCCAGCCAACCTCGCATCCAAAGTGCTCGCTGCATGCCCC
TTCAAAAATCTCTCCCTCCATACTGGCAAATCTAAAGAGAATACATATGGCCAATGCGAAATACAAAGGCTCCTG
AGACCCCTCGCTCACCATAGTCCTGCTCATATAGGTCTCAGTGTTGTCTATCCTGATCCCAAATTATGTGATACC
CTTTCTACGATCTTTTCCGACATCACATCCCTTCATATATGTTATAACGACCCTGAACCTCTTACAACCGTGAAC
GACGGAAGTCACTATCGACAAATTGTCGTTATAGATGACCGTTATTCTTTTATGTGGCAAATTAGACCGCGAACG
ACAATGATGGTACGCTCGCGATAACGAATAACATCATAAGTCTAAGCTAACATAAGTCATAGGGGATATTAGATC
GTCTCGTAACTCGCGAGTCTTCACTCCCGCAAGGCCTTGTCAAATTACGTTTCACCCAAGCAGACCCATATAGCT
CTCGTCAGATTACACGGAAAGAACAACAGGAATATCTGGATAGGCTCCTTTACTCATATAAAGATTTGATGTTCT
TCCAGCTTGGTGATAACCCTCCATTGATAAGGTCCGGAGGAGAGAGGCCGTGGTATGAAGCTGGACAACAGTAAA
TTAGATGTACTTCATATCGGGCATAATCTGACGGTAACAATATGTTTAATATGTTATTGCGGTAAAAATTATTGA
ACGGCTGCAATATAGATACCCACGATCAATTACTGTGTCTGTTGGAGACCAGCCTCCATCAAAGAACGAGCACAA
CATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail