Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|052840
Gene name
Locationscaffold_3:61792..65932
Strand-
Gene length (bp)4140
Transcript length (bp)3801
Coding sequence length (bp)3801
Protein length (aa) 1267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 2.5E-03 766 802
PF13374 TPR_10 Tetratricopeptide repeat 2.6E-10 805 846
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-10 847 888
PF13374 TPR_10 Tetratricopeptide repeat 1.3E-06 889 930
PF13374 TPR_10 Tetratricopeptide repeat 2.5E-10 931 972
PF13374 TPR_10 Tetratricopeptide repeat 4.4E-08 973 1012
PF13374 TPR_10 Tetratricopeptide repeat 3.8E-11 1015 1056
PF13374 TPR_10 Tetratricopeptide repeat 1.9E-08 1057 1098
PF13374 TPR_10 Tetratricopeptide repeat 9.4E-11 1099 1140
PF13374 TPR_10 Tetratricopeptide repeat 3.7E-09 1141 1182
PF13374 TPR_10 Tetratricopeptide repeat 5.6E-11 1183 1224
PF13374 TPR_10 Tetratricopeptide repeat 2.4E-07 1225 1263
PF13424 TPR_12 Tetratricopeptide repeat 3.4E-09 765 828
PF13424 TPR_12 Tetratricopeptide repeat 3.6E-10 852 912
PF13424 TPR_12 Tetratricopeptide repeat 3.8E-09 1017 1080
PF01734 Patatin Patatin-like phospholipase 1.2E-21 13 215
PF00931 NB-ARC NB-ARC domain 6.9E-06 390 605

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 845 1132 1.0E-30
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 845 1137 4.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 845 1147 1.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 845 1147 1.0E-28
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 967 1258 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 845 1132 1.0E-30
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 845 1137 4.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 845 1147 1.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 845 1147 1.0E-28
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 967 1258 4.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 845 1147 9.0E-28
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1016 1260 1.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 845 1132 1.0E-27
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 845 1137 1.0E-27
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 929 1212 2.0E-27
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 925 1215 3.0E-27
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 929 1216 5.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 925 1216 9.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 925 1200 2.0E-26
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 925 1216 3.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 845 1147 3.0E-26
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 929 1216 3.0E-26
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 845 1134 5.0E-26
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 845 1132 7.0E-26
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 845 1132 1.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 925 1232 2.0E-25
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 766 1064 3.0E-25
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 967 1258 4.0E-25
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1016 1262 1.0E-24
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1016 1262 1.0E-24
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1016 1260 1.0E-24
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1016 1258 1.0E-24
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 845 1132 1.0E-24
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 845 1061 1.0E-24
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 929 1216 2.0E-24
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1016 1258 2.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 845 1132 4.0E-24
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1016 1262 6.0E-24
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1016 1260 1.0E-23
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 766 1090 2.0E-23
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 766 1095 2.0E-23
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 929 1211 3.0E-23
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1016 1258 3.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1016 1258 3.0E-23
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 806 1090 4.0E-23
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1055 1248 4.0E-23
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 893 1212 8.0E-23
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1055 1248 1.0E-22
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 971 1216 1.0E-22
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1055 1248 1.0E-22
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1055 1248 1.0E-22
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 756 1080 1.0E-22
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 833 1170 1.0E-22
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1016 1262 2.0E-22
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 892 1212 2.0E-22
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 766 1050 3.0E-22
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1016 1260 5.0E-22
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 766 1021 6.0E-22
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 766 1021 8.0E-22
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 893 1212 8.0E-22
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1055 1248 9.0E-22
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 766 1050 9.0E-22
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 756 1080 1.0E-21
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 833 1170 1.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1016 1226 1.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1016 1226 1.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1016 1206 1.0E-21
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 766 1048 2.0E-21
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 798 1080 2.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1016 1206 2.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 845 1069 2.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1016 1206 2.0E-21
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1055 1248 3.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 845 1038 3.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 845 1069 3.0E-21
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 806 1095 4.0E-21
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 766 964 4.0E-21
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 806 1090 4.0E-21
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 766 1048 4.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 845 1045 5.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 845 1045 6.0E-21
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1055 1248 9.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 929 1135 9.0E-21
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1055 1248 1.0E-20
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 756 1063 1.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 929 1135 1.0E-20
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 798 1080 2.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 929 1144 2.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 929 1144 2.0E-20
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 766 1048 3.0E-20
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 767 1080 3.0E-20
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 917 1212 4.0E-20
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 678 1021 5.0E-20
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 756 1067 5.0E-20
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 766 1048 6.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1055 1248 7.0E-20
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 766 971 8.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1055 1248 9.0E-20
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 892 1212 1.0E-19
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1055 1248 1.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 806 1090 2.0E-19
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 806 1092 2.0E-19
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 806 1090 2.0E-19
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1055 1248 2.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1055 1248 2.0E-19
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 5 332 2.0E-19
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 971 1171 3.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 971 1171 3.0E-19
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 971 1164 3.0E-19
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 971 1164 3.0E-19
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 765 1006 5.0E-19
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 678 996 5.0E-19
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 5 332 5.0E-19
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1097 1250 1.0E-18
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1093 1250 1.0E-18
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1092 1263 2.0E-18
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1093 1263 2.0E-18
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1093 1263 2.0E-18
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 636 1008 3.0E-18
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 5 332 3.0E-18
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 883 1216 4.0E-18
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 8 305 6.0E-18
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1097 1263 7.0E-18
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1097 1246 8.0E-18
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1090 1246 1.0E-17
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 806 1009 1.0E-17
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 806 1009 1.0E-17
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1093 1250 2.0E-17
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 806 1003 2.0E-17
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 806 1003 2.0E-17
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 806 1009 2.0E-17
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 756 1069 4.0E-17
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 765 1008 6.0E-17
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1093 1250 6.0E-17
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 765 1006 7.0E-17
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1097 1246 2.0E-16
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 766 974 2.0E-16
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 883 1080 3.0E-16
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 766 974 3.0E-16
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 766 954 3.0E-16
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 766 954 3.0E-16
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 766 954 5.0E-16
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1093 1246 7.0E-16
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 976 1245 1.0E-15
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 976 1261 1.0E-15
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 798 1002 2.0E-15
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 765 1008 3.0E-15
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1093 1246 1.0E-14
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 765 935 1.0E-14
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1001 1261 1.0E-14
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 798 1002 3.0E-14
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 766 960 7.0E-14
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 744 934 1.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 744 934 1.0E-13
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1008 1261 2.0E-13
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 744 919 3.0E-13
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 744 912 5.0E-13
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 744 912 6.0E-13
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 887 1087 7.0E-13
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 887 1093 7.0E-13
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 887 1093 7.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 887 1087 8.0E-13
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1008 1261 1.0E-12
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1134 1264 2.0E-12
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 766 960 2.0E-12
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1135 1264 3.0E-12
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1139 1264 3.0E-12
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1135 1264 3.0E-12
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1135 1264 5.0E-12
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1132 1264 6.0E-12
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1139 1264 1.0E-11
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1139 1264 1.0E-11
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1139 1264 1.0E-11
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1139 1264 1.0E-11
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1139 1264 1.0E-11
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1139 1264 2.0E-11
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1139 1264 2.0E-11
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1139 1264 2.0E-11
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1139 1264 2.0E-11
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1135 1264 5.0E-11
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 7 244 4.0E-10
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1135 1264 6.0E-10
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 7 218 7.0E-10
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 7 283 1.0E-08
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1043 1264 9.0E-08
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 11 216 1.0E-07
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1043 1264 2.0E-07
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 688 980 3.0E-07
sp|O23181|PLP3_ARATH Patatin-like protein 3 OS=Arabidopsis thaliana GN=PLP3 PE=2 SV=2 36 219 4.0E-07
sp|Q4PA50|CLU_USTMA Clustered mitochondria protein homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLU1 PE=3 SV=1 921 1039 4.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1088 1263 6.0E-06
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1092 1264 8.0E-06
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1018 1264 8.0E-06
sp|Q9FIY1|PLP4_ARATH Patatin-like protein 4 OS=Arabidopsis thaliana GN=PLP4 PE=3 SV=1 60 214 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0043531 ADP binding Yes
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6684 0.4659 0.1807 0.219 0.2039 0.0059 0.0953 0.1257 0.0861 0.0123

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|052840
MTSSAEGQPLRLLALDGGGIRGLSELLIIREVMHKLMFEENEKRKKDGQEPLSVLPKPCDYFDLIGGTSTGGIIA
LMLGRLRMDVETAIKKYNDLAKRVFSTPKQWGDGTFKATTLEEAMKSVVKTVTGDSESPLLESDPAGVCRTFVCA
KNAHDTGIPVLFRTYHSSETHSNCKIWEAARATSAAPTFFKRIEIGRNQPFIDGGLGRNNPSQVVLKEAKALFGA
RSFGCLVSIGAGEAGVIEIKKPGLWQRILPTDAIDALRKITADCESTHEDMLHHFSKLPTAYFRLNVEQGMQGVE
LYEREKLSNVEAHTMQYMKKAEVAKKLALLVSAIRAPRGQLTLEQFMTPGPTNESVPRAGEHKHCPPPVEFFKGR
EEILDKMRKYFELGGDSRRVFVLHGLGGSGKTQIALKFVKESTRFSNVFYIDATNEQTLRTDLEAIALGNTERSV
DASLRWLASRREGSWLLFFDNADDVNLKLKKFFPQCRSGNILVTTRNPDLCLLSTKDGNAKVGAMEHEGAKNLLL
DRAQAEESDENKVLAEAIVQELHYFALAISQAGAYIYCNSSLTKYGEHYRRYHDKLLQSEEFQDQDTYGRAVYAT
WRLSYDKLDVSARSLLQIFSILHHEGISEEMFEKAASSEIQLEDSELQLEDSELQIKVTELLNELGKRGPDWLWD
FKQVIKRLSSYSLIEYDARNETYSIHPLVQQWSRSTMAGNSQLMQKCVLSIIGLSISWTFGEQDYKYRRTLLQHI
SSSRASVDPEQMTPSVLSGLALVYSEHGQWKEAEALQVVVMEKTKQWLGDDHLYTLTSMSNLASTYCHQDQWKEA
EALEVVVMEKRKQLLGDNHPHTLGSMGNLALMYSKQGQWKEAEALQLVVMEKMKQLLGDDHPHTLTNMSSLAATY
DHQGQRKEAEALRMVVMEKRKQLLGDDHPHTLGSMGNLALTYSEQGQLKEAEALQVVVMEKTKELHGDDHPDTLT
SMSHLALTYSNQGQWKEAEALQVVVMEKMKQRLGDNHLHTLASMSNLASTYCHQGQWKEAEALEVVVMEKRKQLL
GDNHPHTLGSMGNLVLMYSKQGQWKEAEALEVVVMKKMKQLLGDDHPHTLMCMGNLALTYSRRGQWKEAEALEVV
VMKKMKQLLGDDHPDTLTSMGNLALTYCHQGHWKEAEALQLVVMEKTKQLRGDDHPDTLTSMANLASTYRKQGQW
KEAEALQVVVMEKTKQLHGDDHPDTLTSMTHLALTYRNQGQWKEAEALEVVLMEKRKQLLGDDYDC*
Coding >AgabiH97|052840
ATGACTTCTTCTGCAGAAGGACAGCCCTTGAGGCTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTATCAGAA
CTACTCATCATCAGGGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAAAAGCGGAAGAAGGACGGTCAAGAA
CCTCTTAGCGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGCATAATTGCT
CTAATGCTTGGGCGTCTTCGGATGGATGTAGAGACAGCAATCAAAAAGTACAATGATCTGGCGAAACGAGTCTTC
TCCACTCCGAAACAATGGGGAGACGGAACATTCAAAGCGACAACACTCGAAGAAGCCATGAAATCTGTCGTGAAG
ACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAAGTGATCCAGCTGGAGTCTGCCGAACTTTCGTTTGTGCA
AAGAACGCCCACGACACAGGCATTCCTGTGCTTTTCAGGACATACCATTCTAGTGAAACGCATTCAAATTGCAAG
ATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACATTTTTTAAGCGCATTGAAATCGGGCGAAACCAGCCC
TTTATCGATGGTGGGCTAGGCCGCAATAATCCGAGTCAGGTGGTACTGAAAGAAGCCAAAGCTCTCTTTGGCGCT
CGTTCATTCGGGTGCTTGGTGAGCATTGGTGCTGGAGAGGCCGGAGTAATCGAGATCAAGAAACCTGGGTTATGG
CAGCGAATCCTACCAACCGATGCCATCGATGCGTTAAGGAAAATTACCGCCGACTGCGAATCAACACACGAAGAT
ATGTTACACCATTTCTCCAAGTTACCGACGGCCTATTTTCGACTAAATGTCGAGCAGGGGATGCAGGGAGTAGAG
CTTTACGAACGGGAGAAACTGAGTAATGTGGAGGCCCATACAATGCAATATATGAAGAAGGCGGAGGTCGCTAAG
AAGCTTGCCTTGTTAGTTAGTGCGATCAGAGCCCCGAGAGGGCAGCTTACACTCGAGCAATTCATGACTCCTGGG
CCTACAAATGAATCGGTCCCACGAGCCGGGGAACACAAGCATTGTCCGCCTCCTGTGGAATTTTTTAAAGGACGA
GAGGAAATTCTTGATAAGATGCGCAAGTATTTTGAGCTGGGGGGTGATTCTCGACGTGTCTTCGTTTTGCATGGC
CTTGGGGGCTCCGGCAAGACCCAAATTGCTCTAAAATTTGTGAAAGAATCAACCCGCTTCTCCAACGTCTTCTAC
ATTGACGCGACCAATGAGCAAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACAGAGCGATCAGTA
GATGCGAGTCTCCGTTGGCTTGCAAGCCGGCGCGAGGGGAGCTGGCTTCTCTTCTTCGACAACGCGGACGATGTG
AACTTGAAACTGAAGAAATTCTTTCCCCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTAACCCAGACCTT
TGCCTTCTCTCTACGAAAGATGGCAATGCAAAAGTTGGTGCGATGGAGCACGAAGGCGCAAAAAACCTCCTGCTG
GATCGGGCTCAGGCAGAAGAGAGCGATGAAAATAAAGTGCTTGCAGAGGCAATTGTACAGGAACTCCATTACTTT
GCTTTGGCTATTTCCCAAGCTGGCGCTTACATTTATTGCAACTCATCATTAACCAAATATGGAGAACACTATCGA
CGTTACCATGACAAACTGTTACAGAGTGAAGAGTTTCAAGACCAAGATACATACGGACGAGCGGTGTATGCGACG
TGGAGACTGAGCTACGACAAACTTGACGTGTCAGCAAGATCTTTGCTCCAAATTTTCTCGATACTACATCACGAA
GGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCTGAAATACAACTGGAGGATTCCGAACTACAACTGGAG
GATTCCGAACTACAAATCAAAGTGACTGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCAGACTGGCTTTGGGAC
TTTAAGCAGGTCATCAAGCGCCTTAGTTCATATTCGCTCATTGAATATGATGCTCGAAATGAGACCTACAGCATC
CATCCACTGGTACAACAGTGGAGTCGTAGCACAATGGCAGGAAACAGTCAGCTCATGCAGAAATGTGTACTCAGC
ATCATTGGCTTATCGATTTCTTGGACATTCGGCGAACAGGACTACAAGTACCGACGCACGCTTTTGCAACATATC
TCCAGCTCCAGAGCCTCGGTCGATCCAGAACAGATGACACCTTCGGTTTTGAGTGGTTTGGCACTTGTGTACTCC
GAACATGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGTGGCTTGGTGAC
GATCATCTTTACACACTCACAAGCATGAGCAATCTTGCGTCTACTTACTGCCACCAGGATCAGTGGAAAGAAGCA
GAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGACAATCATCCTCACACACTTGGGAGC
ATGGGCAATCTTGCGCTCATGTACTCGAAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATG
GAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTCACAAACATGAGCAGTCTTGCGGCCACGTAC
GACCACCAGGGGCAGAGGAAGGAAGCAGAGGCGCTTAGGATGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGT
GACGATCATCCTCACACACTCGGGAGCATGGGCAATCTTGCGCTCACGTACTCGGAACAGGGGCAGTTGAAGGAA
GCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGGAGCTACATGGTGATGATCATCCTGACACACTCACA
AGCATGAGCCATCTTGCGCTCACGTACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAGATGAAGCAGCGGCTTGGTGACAATCATCTTCACACACTCGCAAGCATGAGCAATCTTGCGTCTACT
TACTGCCACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTC
GGTGACAATCATCCTCACACACTTGGGAGCATGGGCAATCTTGTGCTCATGTACTCGAAACAGGGGCAGTGGAAG
GAAGCAGAGGCGCTTGAGGTGGTGGTGATGAAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTC
ATGTGCATGGGCAATCTTGCGCTCACATACTCCAGACGGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTG
GTGATGAAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTGACACACTCACAAGCATGGGCAATCTTGCGCTC
ACGTACTGCCACCAGGGGCATTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGAAGACGAAGCAGCTA
CGCGGTGATGATCATCCTGACACACTCACAAGCATGGCCAATCTTGCCTCTACTTACAGAAAACAGGGGCAGTGG
AAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTACACGGTGATGATCATCCTGACACA
CTCACAAGCATGACCCATCTTGCGCTCACGTACAGAAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTG
GTGTTGATGGAGAAGAGGAAGCAACTGCTTGGTGATGATTATGATTGTTGA
Transcript >AgabiH97|052840
ATGACTTCTTCTGCAGAAGGACAGCCCTTGAGGCTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTATCAGAA
CTACTCATCATCAGGGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAAAAGCGGAAGAAGGACGGTCAAGAA
CCTCTTAGCGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGCATAATTGCT
CTAATGCTTGGGCGTCTTCGGATGGATGTAGAGACAGCAATCAAAAAGTACAATGATCTGGCGAAACGAGTCTTC
TCCACTCCGAAACAATGGGGAGACGGAACATTCAAAGCGACAACACTCGAAGAAGCCATGAAATCTGTCGTGAAG
ACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAAGTGATCCAGCTGGAGTCTGCCGAACTTTCGTTTGTGCA
AAGAACGCCCACGACACAGGCATTCCTGTGCTTTTCAGGACATACCATTCTAGTGAAACGCATTCAAATTGCAAG
ATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACATTTTTTAAGCGCATTGAAATCGGGCGAAACCAGCCC
TTTATCGATGGTGGGCTAGGCCGCAATAATCCGAGTCAGGTGGTACTGAAAGAAGCCAAAGCTCTCTTTGGCGCT
CGTTCATTCGGGTGCTTGGTGAGCATTGGTGCTGGAGAGGCCGGAGTAATCGAGATCAAGAAACCTGGGTTATGG
CAGCGAATCCTACCAACCGATGCCATCGATGCGTTAAGGAAAATTACCGCCGACTGCGAATCAACACACGAAGAT
ATGTTACACCATTTCTCCAAGTTACCGACGGCCTATTTTCGACTAAATGTCGAGCAGGGGATGCAGGGAGTAGAG
CTTTACGAACGGGAGAAACTGAGTAATGTGGAGGCCCATACAATGCAATATATGAAGAAGGCGGAGGTCGCTAAG
AAGCTTGCCTTGTTAGTTAGTGCGATCAGAGCCCCGAGAGGGCAGCTTACACTCGAGCAATTCATGACTCCTGGG
CCTACAAATGAATCGGTCCCACGAGCCGGGGAACACAAGCATTGTCCGCCTCCTGTGGAATTTTTTAAAGGACGA
GAGGAAATTCTTGATAAGATGCGCAAGTATTTTGAGCTGGGGGGTGATTCTCGACGTGTCTTCGTTTTGCATGGC
CTTGGGGGCTCCGGCAAGACCCAAATTGCTCTAAAATTTGTGAAAGAATCAACCCGCTTCTCCAACGTCTTCTAC
ATTGACGCGACCAATGAGCAAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACAGAGCGATCAGTA
GATGCGAGTCTCCGTTGGCTTGCAAGCCGGCGCGAGGGGAGCTGGCTTCTCTTCTTCGACAACGCGGACGATGTG
AACTTGAAACTGAAGAAATTCTTTCCCCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTAACCCAGACCTT
TGCCTTCTCTCTACGAAAGATGGCAATGCAAAAGTTGGTGCGATGGAGCACGAAGGCGCAAAAAACCTCCTGCTG
GATCGGGCTCAGGCAGAAGAGAGCGATGAAAATAAAGTGCTTGCAGAGGCAATTGTACAGGAACTCCATTACTTT
GCTTTGGCTATTTCCCAAGCTGGCGCTTACATTTATTGCAACTCATCATTAACCAAATATGGAGAACACTATCGA
CGTTACCATGACAAACTGTTACAGAGTGAAGAGTTTCAAGACCAAGATACATACGGACGAGCGGTGTATGCGACG
TGGAGACTGAGCTACGACAAACTTGACGTGTCAGCAAGATCTTTGCTCCAAATTTTCTCGATACTACATCACGAA
GGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCTGAAATACAACTGGAGGATTCCGAACTACAACTGGAG
GATTCCGAACTACAAATCAAAGTGACTGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCAGACTGGCTTTGGGAC
TTTAAGCAGGTCATCAAGCGCCTTAGTTCATATTCGCTCATTGAATATGATGCTCGAAATGAGACCTACAGCATC
CATCCACTGGTACAACAGTGGAGTCGTAGCACAATGGCAGGAAACAGTCAGCTCATGCAGAAATGTGTACTCAGC
ATCATTGGCTTATCGATTTCTTGGACATTCGGCGAACAGGACTACAAGTACCGACGCACGCTTTTGCAACATATC
TCCAGCTCCAGAGCCTCGGTCGATCCAGAACAGATGACACCTTCGGTTTTGAGTGGTTTGGCACTTGTGTACTCC
GAACATGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGTGGCTTGGTGAC
GATCATCTTTACACACTCACAAGCATGAGCAATCTTGCGTCTACTTACTGCCACCAGGATCAGTGGAAAGAAGCA
GAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGACAATCATCCTCACACACTTGGGAGC
ATGGGCAATCTTGCGCTCATGTACTCGAAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATG
GAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTCACAAACATGAGCAGTCTTGCGGCCACGTAC
GACCACCAGGGGCAGAGGAAGGAAGCAGAGGCGCTTAGGATGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGT
GACGATCATCCTCACACACTCGGGAGCATGGGCAATCTTGCGCTCACGTACTCGGAACAGGGGCAGTTGAAGGAA
GCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGGAGCTACATGGTGATGATCATCCTGACACACTCACA
AGCATGAGCCATCTTGCGCTCACGTACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAGATGAAGCAGCGGCTTGGTGACAATCATCTTCACACACTCGCAAGCATGAGCAATCTTGCGTCTACT
TACTGCCACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTC
GGTGACAATCATCCTCACACACTTGGGAGCATGGGCAATCTTGTGCTCATGTACTCGAAACAGGGGCAGTGGAAG
GAAGCAGAGGCGCTTGAGGTGGTGGTGATGAAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTC
ATGTGCATGGGCAATCTTGCGCTCACATACTCCAGACGGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTG
GTGATGAAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCTGACACACTCACAAGCATGGGCAATCTTGCGCTC
ACGTACTGCCACCAGGGGCATTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGAAGACGAAGCAGCTA
CGCGGTGATGATCATCCTGACACACTCACAAGCATGGCCAATCTTGCCTCTACTTACAGAAAACAGGGGCAGTGG
AAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTACACGGTGATGATCATCCTGACACA
CTCACAAGCATGACCCATCTTGCGCTCACGTACAGAAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTG
GTGTTGATGGAGAAGAGGAAGCAACTGCTTGGTGATGATTATGATTGTTGA
Gene >AgabiH97|052840
ATGACTTCTTCTGCAGAAGGACAGCCCTTGAGGCTGCTTGCGCTAGGTACATGCGTCCGTTTGCACTCTCTCGCC
GATAGAGTCGCTGACTAGTAAACTCTGAACAGATGGCGGTGGGATTCGCGGACTATCAGAACTACTCATCATCAG
GGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAAAAGCGGAAGAAGGACGGTCAAGAACCTCTTAGCGTACT
CCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGGTGCGCTGCGTTATACACCCACAA
TCGTCTCATCTTACTCACATGTATATTACAGCATAATTGCTCTAATGCTTGGGCGTCTTCGGATGGATGTAGAGA
CAGCAATCAAAAAGTACAATGATCTGGCGAAACGAGTCTTCTCCACTCCGAAACAATGGGGAGACGGAACATTCA
AAGCGACAACACTCGAAGAAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAG
AAAGTGATCCAGCTGGAGTCTGCCGAACGTGAGTATATTACTTACTCTTCCATACATTTGGACTTTGAATTCAAA
GATTTATTAGTTTCGTTTGTGCAAAGAACGCCCACGACACAGGCATTCCTGTGCTTTTCAGGACATACCATTCTA
GTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACATTTTTTAAGCGCA
TTGAAATCGGGCGAAACCAGCCCTTTATCGATGGTGGGCTAGGCCGCAATAATCCGAGTCAGGTGGTACTGAAAG
AAGCCAAAGCTCTCTTTGGCGCTCGTTCATTCGGGTGCTTGGTGAGCATTGGTGCTGGAGAGGCCGGAGTAATCG
AGATCAAGAAACCTGGGTTATGGCAGCGAATCCTACCAACCGATGCCATCGATGCGTTAAGGAAAATTACCGCCG
ACTGCGAATCAACACACGAAGATATGTTACACCATTTCTCCAAGTTACCGACGGCCTATTTTCGACTAAATGTCG
AGCAGGGGATGCAGGGAGTAGAGCTTTACGAACGGGAGAAACTGAGTAATGTGGAGGCCCATACAATGCAATATA
TGAAGAAGGCGGAGGTCGCTAAGAAGCTTGCCTTGTTAGTTAGTGCGATCAGAGCCCCGAGAGGGCAGCTTACAC
TCGAGCAATTCAGTATGGAAATCGCTCTTAGATCTTCATAATAACCTAATCTTGTCAAACTAGTGACTCCTGGGC
CTACAAATGAATCGGTCCCACGAGCCGGGGAACACAAGCATTGTCCGCCTCCTGTGGAATTTTTTAAAGGACGAG
AGGAAATTCTTGATAAGATGCGCAAGTATTTTGAGCTGGGGGGTGATTCTCGACGTGTCTTCGTTTTGCATGGCC
TTGGGGGCTCCGGCAAGACCCAAATTGCTCTAAAATTTGTGAAAGAATCAACCCGGTATGATTTTACTCTACAAA
TGCGAGACTGGCGACAATTTATATGTATAATTTCTAGCTTCTCCAACGTCTTCTACATTGACGCGACCAATGAGC
AAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCGTTGGC
TTGCAAGCCGGCGCGAGGGGAGCTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAAT
TCTTTCCCCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTAACCCAGACCTTTGCCTTCTCTCTACGAAAG
ATGGCAATGCAAAAGTTGGTGCGATGGAGCACGAAGGCGCAAAAAACCTCCTGCTGGATCGGGCTCAGGCAGAAG
AGAGCGATGAAAATAAAGTGCTTGCAGAGGCAATTGTACAGGTTCTTCCTCTCATTTTCGTTTCTTTAGAAAGCG
CTTTCAGTCTAACGCACAAGACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTTAT
TGCAACTCATCATTAACCAAATATGGAGAACACTATCGACGTTACCATGACAAACTGTTACAGAGTGAAGAGTTT
CAAGACCAAGATACATACGGACGAGCGGTGTATGCGACGTGGAGACTGAGCTACGACAAACTTGACGTGTCAGCA
AGATCTTTGCTCCAAATTTTCTCGATACTACATCACGAAGGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCG
TCTGAAATACAACTGGAGGATTCCGAACTACAACTGGAGGATTCCGAACTACAAATCAAAGTGACTGAGTTGCTG
AACGAGCTGGGAAAACGAGGTCCAGACTGGCTTTGGGACTTTAAGCAGGTCATCAAGCGCCTTAGTTCATATTCG
CTCATTGAATATGATGCTCGAAATGAGACCTACAGCATCCATCCACTGGTACAACAGTGGAGTCGTAGCACAATG
GCAGGAAACAGTCAGCTCATGCAGAAATGTGTACTCAGCATCATTGGCTTATCGATTTCTTGGACATTCGGCGAA
CAGGACTACAAGTACCGACGCACGCTTTTGCAACATATCTCCAGCTCCAGAGCCTCGGTCGATCCAGAACAGATG
ACACCTTCGGTTTTGAGTGGTTTGGCACTTGTGTACTCCGAACATGGGCAGTGGAAGGAAGCAGAGGCGCTTCAG
GTGGTGGTGATGGAGAAGACGAAGCAGTGGCTTGGTGACGATCATCTTTACACACTCACAAGCATGAGCAATCTT
GCGTCTACTTACTGCCACCAGGATCAGTGGAAAGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAG
CAGCTGCTCGGTGACAATCATCCTCACACACTTGGGAGCATGGGCAATCTTGCGCTCATGTACTCGAAACAGGGG
CAGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGAAGATGAAGCAGCTGCTCGGTGACGATCATCCT
CACACACTCACAAACATGAGCAGTCTTGCGGCCACGTACGACCACCAGGGGCAGAGGAAGGAAGCAGAGGCGCTT
AGGATGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTCGGGAGCATGGGCAAT
CTTGCGCTCACGTACTCGGAACAGGGGCAGTTGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACG
AAGGAGCTACATGGTGATGATCATCCTGACACACTCACAAGCATGAGCCATCTTGCGCTCACGTACTCGAACCAG
GGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCAGCGGCTTGGTGACAATCAT
CTTCACACACTCGCAAGCATGAGCAATCTTGCGTCTACTTACTGCCACCAGGGGCAGTGGAAGGAAGCAGAGGCG
CTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGACAATCATCCTCACACACTTGGGAGCATGGGC
AATCTTGTGCTCATGTACTCGAAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGAAGAAG
ATGAAGCAGCTGCTCGGTGACGATCATCCTCACACACTCATGTGCATGGGCAATCTTGCGCTCACATACTCCAGA
CGGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGAAGAAGATGAAGCAGCTGCTCGGTGACGAT
CATCCTGACACACTCACAAGCATGGGCAATCTTGCGCTCACGTACTGCCACCAGGGGCATTGGAAGGAAGCAGAG
GCGCTTCAGTTGGTGGTGATGGAGAAGACGAAGCAGCTACGCGGTGATGATCATCCTGACACACTCACAAGCATG
GCCAATCTTGCCTCTACTTACAGAAAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAG
AAGACGAAGCAGCTACACGGTGATGATCATCCTGACACACTCACAAGCATGACCCATCTTGCGCTCACGTACAGA
AACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGTTGATGGAGAAGAGGAAGCAACTGCTTGGTGAT
GATTATGATTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail