Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|052780
Gene name
Locationscaffold_3:41968..44121
Strand+
Gene length (bp)2153
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.0E-24 123 419
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-10 314 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 88 489 1.0E-52
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 71 490 3.0E-46
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 101 483 2.0E-25
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 101 483 6.0E-25
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 101 483 7.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 88 489 1.0E-52
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 71 490 3.0E-46
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 101 483 2.0E-25
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 101 483 6.0E-25
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 101 483 7.0E-25
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 88 486 2.0E-23
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 74 486 3.0E-19
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 53 476 2.0E-18
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 108 476 5.0E-18
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 101 412 4.0E-17
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 73 407 1.0E-16
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 101 470 6.0E-15
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 88 475 2.0E-14
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 101 482 2.0E-13
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 101 485 8.0E-13
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 101 485 2.0E-12
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 101 474 3.0E-12
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 101 485 4.0E-12
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 101 471 4.0E-12
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 101 471 6.0E-12
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 102 474 9.0E-12
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 102 481 2.0E-11
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 101 485 3.0E-11
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 101 481 3.0E-11
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 101 479 1.0E-10
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 102 488 4.0E-10
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 101 479 7.0E-10
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 101 484 1.0E-09
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 285 482 1.0E-09
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 102 481 4.0E-09
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 87 481 8.0E-09
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 102 488 8.0E-09
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 101 470 1.0E-08
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 292 482 1.0E-07
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 101 287 2.0E-07
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 101 489 3.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 101 287 9.0E-07
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 101 287 1.0E-06
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 76 291 1.0E-06
sp|O15374|MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1 299 470 2.0E-06
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 101 489 2.0E-06
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 101 489 3.0E-06
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 77 294 3.0E-06
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 101 287 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 103 125 22
2 148 170 22
3 177 194 17
4 204 226 22
5 233 255 22
6 265 284 19
7 312 334 22
8 344 363 19
9 370 392 22
10 396 418 22
11 434 456 22
12 466 488 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|052780
MLYRPSLTSNIKISIEPHFLALTPLPTHPAAVLICPICRQRLPANSPGARWVLVPTHQESLQKLSGEARQVTRND
DNEDLRGKFELEEKEESISNADDHFPDGGLAAWLVVFGGMCNTYCTFGYVNSWGIFQAYYQETFLKDYSPSTIAW
IGSLQYALIFFPALIVGRLFDIGRFREVFLSASTLLVVATFLTAECTQYWQFLLCQGIAVGLACGGVFGCCYPIV
AHWFKKRRGLAMGIVAIGSSLGGTTIPIAVKQLIPQVGFQWTMRIIGFLLLAVIGVCNLTMRRRLPPVNVKGGLL
NLAAFKNASYTIYCISSLINFLGLYTVLTYVSVSAESLGSSSDLAFYFVSIANAASCFGRWWGGMFADRIGAITV
MIPSTLAAGILTYAWPFARSTASLIVVTILYGFCSGIYVALLSNPMMDIGGEGDVGRRVGMFMSITALGAVAGPP
ISGAINAGTGGYQGVGYYAGSMVVVGVSLMIVVRYLTLGGWTGKM*
Coding >AgabiH97|052780
ATGTTGTATCGTCCTTCTCTTACGTCAAACATAAAAATCAGTATTGAGCCGCACTTTCTAGCTCTTACACCACTA
CCTACCCACCCAGCCGCCGTACTCATTTGTCCCATATGTCGACAGAGGCTGCCAGCGAACAGCCCCGGCGCTCGT
TGGGTTCTGGTGCCAACGCACCAGGAATCGTTGCAAAAGCTGAGCGGAGAAGCCCGCCAGGTGACCCGTAATGAT
GACAACGAAGATCTACGAGGCAAATTCGAACTAGAAGAGAAGGAGGAGTCTATATCGAACGCTGATGATCATTTT
CCGGATGGCGGGTTGGCAGCTTGGCTGGTAGTCTTTGGTGGAATGTGTAATACTTATTGCACGTTCGGCTATGTC
AACTCCTGGGGTATATTCCAAGCCTATTATCAAGAAACCTTTCTTAAGGACTATTCTCCTTCGACGATCGCATGG
ATAGGCTCGCTCCAATATGCCCTGATATTCTTTCCCGCTCTCATCGTTGGTCGTCTATTCGATATCGGTCGTTTT
AGAGAAGTATTCCTTTCCGCAAGCACCCTTCTCGTTGTCGCAACATTTTTAACCGCAGAATGCACGCAATATTGG
CAATTTTTATTATGCCAGGGTATTGCTGTCGGGCTTGCATGCGGCGGCGTTTTTGGCTGTTGCTATCCGATTGTT
GCTCATTGGTTCAAGAAGAGGCGGGGACTTGCGATGGGAATAGTAGCTATTGGATCCTCATTGGGTGGAACAACG
ATCCCCATTGCCGTTAAGCAGTTGATCCCCCAAGTTGGATTCCAGTGGACGATGAGGATAATCGGGTTTTTACTT
CTCGCAGTCATCGGTGTGTGTAACCTGACCATGAGGCGACGACTTCCACCTGTCAACGTAAAAGGCGGTTTATTG
AATCTCGCCGCATTCAAAAACGCGTCATACACTATTTATTGTATTTCTTCACTCATCAACTTTCTGGGTCTCTAT
ACCGTTTTGACCTATGTCAGCGTCAGCGCAGAGTCACTAGGGTCTTCCTCGGATTTAGCATTTTATTTTGTTTCA
ATCGCTAATGCAGCTTCATGTTTTGGTCGATGGTGGGGAGGAATGTTCGCAGACAGGATAGGTGCCATCACCGTA
ATGATTCCTTCAACACTCGCAGCAGGTATCTTGACCTACGCTTGGCCATTTGCCAGGTCCACCGCTTCTCTCATC
GTAGTCACTATTCTTTATGGCTTCTGTTCTGGAATATATGTTGCGCTCTTGTCTAATCCGATGATGGATATCGGG
GGCGAAGGAGATGTCGGGAGACGTGTTGGGATGTTTATGTCGATAACGGCTCTGGGTGCAGTCGCTGGACCACCG
ATCTCAGGTGCTATAAATGCGGGGACGGGCGGGTACCAGGGTGTTGGCTATTACGCAGGGAGTATGGTTGTTGTA
GGAGTTTCATTGATGATTGTTGTAAGATACCTTACGCTTGGAGGCTGGACGGGTAAAATGTGA
Transcript >AgabiH97|052780
ATGTTGTATCGTCCTTCTCTTACGTCAAACATAAAAATCAGTATTGAGCCGCACTTTCTAGCTCTTACACCACTA
CCTACCCACCCAGCCGCCGTACTCATTTGTCCCATATGTCGACAGAGGCTGCCAGCGAACAGCCCCGGCGCTCGT
TGGGTTCTGGTGCCAACGCACCAGGAATCGTTGCAAAAGCTGAGCGGAGAAGCCCGCCAGGTGACCCGTAATGAT
GACAACGAAGATCTACGAGGCAAATTCGAACTAGAAGAGAAGGAGGAGTCTATATCGAACGCTGATGATCATTTT
CCGGATGGCGGGTTGGCAGCTTGGCTGGTAGTCTTTGGTGGAATGTGTAATACTTATTGCACGTTCGGCTATGTC
AACTCCTGGGGTATATTCCAAGCCTATTATCAAGAAACCTTTCTTAAGGACTATTCTCCTTCGACGATCGCATGG
ATAGGCTCGCTCCAATATGCCCTGATATTCTTTCCCGCTCTCATCGTTGGTCGTCTATTCGATATCGGTCGTTTT
AGAGAAGTATTCCTTTCCGCAAGCACCCTTCTCGTTGTCGCAACATTTTTAACCGCAGAATGCACGCAATATTGG
CAATTTTTATTATGCCAGGGTATTGCTGTCGGGCTTGCATGCGGCGGCGTTTTTGGCTGTTGCTATCCGATTGTT
GCTCATTGGTTCAAGAAGAGGCGGGGACTTGCGATGGGAATAGTAGCTATTGGATCCTCATTGGGTGGAACAACG
ATCCCCATTGCCGTTAAGCAGTTGATCCCCCAAGTTGGATTCCAGTGGACGATGAGGATAATCGGGTTTTTACTT
CTCGCAGTCATCGGTGTGTGTAACCTGACCATGAGGCGACGACTTCCACCTGTCAACGTAAAAGGCGGTTTATTG
AATCTCGCCGCATTCAAAAACGCGTCATACACTATTTATTGTATTTCTTCACTCATCAACTTTCTGGGTCTCTAT
ACCGTTTTGACCTATGTCAGCGTCAGCGCAGAGTCACTAGGGTCTTCCTCGGATTTAGCATTTTATTTTGTTTCA
ATCGCTAATGCAGCTTCATGTTTTGGTCGATGGTGGGGAGGAATGTTCGCAGACAGGATAGGTGCCATCACCGTA
ATGATTCCTTCAACACTCGCAGCAGGTATCTTGACCTACGCTTGGCCATTTGCCAGGTCCACCGCTTCTCTCATC
GTAGTCACTATTCTTTATGGCTTCTGTTCTGGAATATATGTTGCGCTCTTGTCTAATCCGATGATGGATATCGGG
GGCGAAGGAGATGTCGGGAGACGTGTTGGGATGTTTATGTCGATAACGGCTCTGGGTGCAGTCGCTGGACCACCG
ATCTCAGGTGCTATAAATGCGGGGACGGGCGGGTACCAGGGTGTTGGCTATTACGCAGGGAGTATGGTTGTTGTA
GGAGTTTCATTGATGATTGTTGTAAGATACCTTACGCTTGGAGGCTGGACGGGTAAAATGTGA
Gene >AgabiH97|052780
ATGTTGTATCGTCCTTCTCTTACGTCAAACATAAAAATCAGTATTGAGCCGCACTTTCTAGCTCTTACACCACTA
CCTACCCACCCAGCCGCCGTACTCATTTGTCCCATATGTCGACAGAGGCTGCCAGCGAACAGCCCCGGCGCTCGT
TGTCCGCACCATCTTCCACTGTGTTCGTCGCACAAGAAAATGATGTAATTCGTAAAAATATTTCAGGGGTTCTGG
TGCCAACGCACCAGGAATCGTTGCAAAAGCTGAGCGGAGAAGCCCGCCAGGTGACCCGTAATGATGACAACGAAG
ATCTACGAGGCAAATTCGAACTAGAAGAGAAGGAGGAGTCTATATCGAACGCTGATGATCATTTTCCGGATGGCG
GGTTGGCAGCTTGGCTGGTAGTCTTTGGTGTAAGTTTTGTTCTATCCTTTCCACTGTCGCCCTCGATTGAGACCC
AAATTTTTTAGGGAATGTGTAATACTTATTGCACGTGAGCTGATGTTATGCTATTTCTTTTCGCTTGTGCCACTC
ACAAGGAGTTAGGTTCGGCTATGTCAACTCCTGGGGTGTATGTTCTTTTGCTTGAACGGAAAGGACAGAGCCTCA
CATAACTCAAAGATATTCCAAGCCTATTATCAAGAAACCTTTCTTAAGGACTATTCTCCTTCGACGATGTAAGTC
TACATTTCAAACATCGTTCAATCCCTGCCTGACATTCATTAGCGCATGGATAGGCTCGCTCCAAGTACTTCTTTT
CGTCTTATACCCTCGTTCCCTATTCTCAGCCCCATCCTTCATTCATTAGTATGCCCTGATATTCTTTCCCGCTCT
CATCGTTGGTCGTCTATTCGATATCGGTCGTTTTAGAGAAGTATTCCTTTCCGCAAGCACCCTTCTCGTTGTCGC
AACATTTTTAACCGCAGAATGCACGCAATATTGGCAATTTTTATTATGCCAGGGTATTGCTGTCGGGGTATGTCC
GTTCATCAATGCCTCTAAATCTGCTGTATTTATATGAGGATGACTGCGTAGCTTGCATGCGGCGGCGTTTTTGGC
TGTTGCTATCCGATTGTTGCTCATTGGTTCAAGAAGAGGCGGGGACTTGCGATGGGAATAGTAGCTATTGGATCC
TCATTGGGTGGAACAACGATCCCCATTGCCGTTAAGCAGTTGATCCCCCAAGTTGGGTGTGTAAGACCTCTTGAT
TTCGAAACTGTGCGCAACTTAAACTTGTGCGCTTTTCAGATTCCAGTGGACGATGAGGATAATCGGGTTTTTACT
TCTCGCAGTCATCGGTGTGTGTAACCTGGTACGTAAAATCGCGCAAGTTCAGAAAACTTGATTTATCATTGACGT
GCTTAGACCATGAGGCGACGACTTCCACCTGTCAACGTAAAAGGCGGTTTATTGAATCTCGCCGCATTCAAAAAC
GCGTCATACACTATTTATTGTATTTCTTCACTCATCAACTTTCTGGGTCTCTATACCGGTAAATCTTTTTTAGTC
GTTCATTCAGCTCACCCATTGACTGTTCTCAAGTTTTGACCTATGTCAGCGTCAGCGCAGAGTCACTAGGGTCTT
CCTCGGATTTAGCATTTTATTTTGTTTCAATCGCTAATGCAGCTTCATGTTTTGGTCGATGGTGGGGAGGAATGT
TCGCAGACAGGATAGGTAAAAACAATTTGCGACACTATGATTTTCCTTCTCATTTAGTTTGTTTTATAGGTGCCA
TCACCGTAATGATTCCTTCAACACTCGCAGCAGGTATCTTGACCTACGCTTGGCCATTTGCCAGGTCCACCGCTT
CTCTCATCGTAGTCACTATTCTTTATGGCTTCTGTTCTGGAATATATGTTGCGCTCTTGTCTAATCCGATGATGG
ATATCGGGGGCGAAGGAGATGTCGGGAGACGTGTTGGGATGTTTATGTCGATAACGGCTCTGGGTGCAGTCGCTG
GACCACCGATCTCAGGTGCTATAAATGCGGGGACGGGCGGGTACCAGGGTGTTGGCTATTACGCAGGTTAGTCCA
ATTTGCTTCAAAGTGGTTGTTGGATTTTAACGTGGTTTTTTTACCTAGGGAGTATGGTTGTTGTAGGAGTTTCAT
TGATGATTGTTGTAAGATACCTTACGCTTGGAGGCTGGACGGGTAAAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail