Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|052730
Gene name
Locationscaffold_3:30265..31456
Strand+
Gene length (bp)1191
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 8.0E-82 8 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76251|DMLA_ECOLI D-malate dehydrogenase [decarboxylating] OS=Escherichia coli (strain K12) GN=dmlA PE=1 SV=1 9 372 3.0E-160
sp|Q51945|TTUC_PSEPU Tartrate dehydrogenase/decarboxylase OS=Pseudomonas putida PE=1 SV=3 7 375 2.0E-154
sp|P42958|TTUC_BACSU Probable tartrate dehydrogenase/decarboxylase OS=Bacillus subtilis (strain 168) GN=ycsA PE=3 SV=4 5 339 1.0E-111
sp|Q44471|TTUC1_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 5 377 6.0E-107
sp|O34296|TTUC3_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 5 377 6.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76251|DMLA_ECOLI D-malate dehydrogenase [decarboxylating] OS=Escherichia coli (strain K12) GN=dmlA PE=1 SV=1 9 372 3.0E-160
sp|Q51945|TTUC_PSEPU Tartrate dehydrogenase/decarboxylase OS=Pseudomonas putida PE=1 SV=3 7 375 2.0E-154
sp|P42958|TTUC_BACSU Probable tartrate dehydrogenase/decarboxylase OS=Bacillus subtilis (strain 168) GN=ycsA PE=3 SV=4 5 339 1.0E-111
sp|Q44471|TTUC1_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 5 377 6.0E-107
sp|O34296|TTUC3_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 5 377 6.0E-107
sp|O34295|TTUC5_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 5 377 1.0E-106
sp|P70792|TTUC4_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 5 377 2.0E-106
sp|P70787|TTUC2_AGRVI Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 5 377 3.0E-106
sp|C4LJH3|LEU3_CORK4 3-isopropylmalate dehydrogenase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=leuB PE=3 SV=1 9 347 4.0E-82
sp|Q47SB4|LEU3_THEFY 3-isopropylmalate dehydrogenase OS=Thermobifida fusca (strain YX) GN=leuB PE=3 SV=1 5 338 2.0E-81
sp|O86504|LEU3_STRCO 3-isopropylmalate dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuB PE=3 SV=1 4 338 2.0E-80
sp|B1VZ57|LEU3_STRGG 3-isopropylmalate dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuB PE=3 SV=1 4 327 2.0E-78
sp|C5C2I9|LEU3_BEUC1 3-isopropylmalate dehydrogenase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=leuB PE=3 SV=1 4 357 2.0E-78
sp|Q8G500|LEU3_BIFLO 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=leuB PE=3 SV=1 5 338 1.0E-74
sp|B3DTF8|LEU3_BIFLD 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain DJO10A) GN=leuB PE=3 SV=1 5 338 1.0E-74
sp|Q4JUQ0|LEU3_CORJK 3-isopropylmalate dehydrogenase OS=Corynebacterium jeikeium (strain K411) GN=leuB PE=3 SV=1 9 332 1.0E-74
sp|B7GUI8|LEU3_BIFLS 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuB PE=3 SV=1 5 338 4.0E-74
sp|A4QDP9|LEU3_CORGB 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain R) GN=leuB PE=3 SV=1 9 332 4.0E-74
sp|P94631|LEU3_CORGL 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuB PE=3 SV=1 9 332 4.0E-74
sp|Q82JN6|LEU3_STRAW 3-isopropylmalate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuB PE=3 SV=1 5 357 1.0E-73
sp|A5CPZ4|LEU3_CLAM3 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=leuB PE=3 SV=1 5 336 2.0E-72
sp|B1VG35|LEU3_CORU7 3-isopropylmalate dehydrogenase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=leuB PE=3 SV=1 9 334 4.0E-72
sp|Q8FPV5|LEU3_COREF 3-isopropylmalate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuB PE=3 SV=2 9 335 6.0E-72
sp|A4TE12|LEU3_MYCGI 3-isopropylmalate dehydrogenase OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuB PE=3 SV=1 9 342 4.0E-71
sp|Q5YRX2|LEU3_NOCFA 3-isopropylmalate dehydrogenase OS=Nocardia farcinica (strain IFM 10152) GN=leuB PE=3 SV=1 9 323 9.0E-71
sp|B0RIP4|LEU3_CLAMS 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=leuB PE=3 SV=1 5 320 3.0E-70
sp|C0ZXM4|LEU3_RHOE4 3-isopropylmalate dehydrogenase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=leuB PE=3 SV=1 9 323 4.0E-70
sp|A8L554|LEU3_FRASN 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain EAN1pec) GN=leuB PE=3 SV=1 9 325 6.0E-70
sp|Q1BAR4|LEU3_MYCSS 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain MCS) GN=leuB PE=3 SV=1 8 344 1.0E-69
sp|A1UE98|LEU3_MYCSK 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain KMS) GN=leuB PE=3 SV=1 8 344 1.0E-69
sp|A3PXQ2|LEU3_MYCSJ 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain JLS) GN=leuB PE=3 SV=1 8 344 1.0E-69
sp|Q6NHM7|LEU3_CORDI 3-isopropylmalate dehydrogenase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuB PE=3 SV=1 9 332 1.0E-69
sp|C3PFX5|LEU3_CORA7 3-isopropylmalate dehydrogenase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=leuB PE=3 SV=1 9 345 7.0E-69
sp|Q6AEP6|LEU3_LEIXX 3-isopropylmalate dehydrogenase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuB PE=3 SV=1 4 357 2.0E-68
sp|Q73VI1|LEU3_MYCPA 3-isopropylmalate dehydrogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuB PE=3 SV=1 9 336 3.0E-68
sp|A4FMQ2|LEU3_SACEN 3-isopropylmalate dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuB PE=3 SV=1 9 322 4.0E-68
sp|A0QJC2|LEU3_MYCA1 3-isopropylmalate dehydrogenase OS=Mycobacterium avium (strain 104) GN=leuB PE=3 SV=1 9 336 6.0E-68
sp|A1T6Z4|LEU3_MYCVP 3-isopropylmalate dehydrogenase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuB PE=3 SV=1 9 341 8.0E-68
sp|C1AGB0|LEU3_MYCBT 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuB PE=3 SV=1 9 355 1.0E-67
sp|A1KMY9|LEU3_MYCBP 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuB PE=3 SV=1 9 355 1.0E-67
sp|P94929|LEU3_MYCBO 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuB PE=3 SV=1 9 355 1.0E-67
sp|Q0S2H1|LEU3_RHOJR 3-isopropylmalate dehydrogenase OS=Rhodococcus jostii (strain RHA1) GN=leuB PE=3 SV=1 9 344 3.0E-67
sp|P9WKK9|LEU3_MYCTU 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuB PE=1 SV=1 9 355 3.0E-67
sp|P9WKK8|LEU3_MYCTO 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuB PE=3 SV=1 9 355 3.0E-67
sp|A5U706|LEU3_MYCTA 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuB PE=3 SV=1 9 355 3.0E-67
sp|B2HIH1|LEU3_MYCMM 3-isopropylmalate dehydrogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuB PE=3 SV=1 9 336 7.0E-67
sp|C1B2M3|LEU3_RHOOB 3-isopropylmalate dehydrogenase OS=Rhodococcus opacus (strain B4) GN=leuB PE=3 SV=1 9 344 1.0E-66
sp|A0PPY6|LEU3_MYCUA 3-isopropylmalate dehydrogenase OS=Mycobacterium ulcerans (strain Agy99) GN=leuB PE=3 SV=1 9 336 8.0E-66
sp|Q2J6V8|LEU3_FRASC 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain CcI3) GN=leuB PE=3 SV=1 9 321 2.0E-64
sp|O33117|LEU3_MYCLE 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=leuB PE=3 SV=1 9 336 3.0E-64
sp|B8ZS15|LEU3_MYCLB 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain Br4923) GN=leuB PE=3 SV=1 9 336 3.0E-64
sp|Q58130|LEU3_METJA 3-isopropylmalate/3-methylmalate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuB PE=1 SV=2 6 372 3.0E-64
sp|Q5SIJ1|HICDH_THET8 Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hicd PE=1 SV=1 7 375 9.0E-64
sp|Q72IW9|HICDH_THET2 Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hicd PE=1 SV=1 7 375 9.0E-64
sp|Q6ANR1|LEU3_DESPS 3-isopropylmalate dehydrogenase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=leuB PE=3 SV=1 6 339 1.0E-62
sp|P24098|LEU3_THEAQ 3-isopropylmalate dehydrogenase OS=Thermus aquaticus GN=leuB PE=3 SV=1 9 338 5.0E-62
sp|O29627|LEU3_ARCFU 3-isopropylmalate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuB PE=3 SV=1 6 361 8.0E-62
sp|P41019|LEU3_BACMD 3-isopropylmalate dehydrogenase OS=Bacillus megaterium (strain DSM 319) GN=leuB PE=3 SV=2 9 349 1.0E-61
sp|Q7N128|LEU3_PHOLL 3-isopropylmalate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuB PE=3 SV=1 7 358 5.0E-61
sp|Q67JY2|LEU3_SYMTH 3-isopropylmalate dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuB PE=3 SV=1 7 373 2.0E-60
sp|O27441|LEU3_METTH 3-isopropylmalate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuB PE=3 SV=1 9 370 2.0E-60
sp|Q3IJS3|LEU3_PSEHT 3-isopropylmalate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuB PE=3 SV=1 1 328 8.0E-60
sp|Q9CJN6|LEU3_PASMU 3-isopropylmalate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=leuB PE=3 SV=1 5 357 2.0E-59
sp|Q7V842|LEU3_PROMM 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuB PE=3 SV=1 5 348 7.0E-59
sp|Q3AEQ2|LEU3_CARHZ 3-isopropylmalate dehydrogenase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuB PE=3 SV=1 7 353 9.0E-59
sp|Q5KWJ4|LEU3_GEOKA 3-isopropylmalate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=leuB PE=3 SV=1 7 339 9.0E-59
sp|Q46LE2|LEU3_PROMT 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain NATL2A) GN=leuB PE=3 SV=1 7 367 1.0E-58
sp|Q9K8E9|LEU3_BACHD 3-isopropylmalate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuB PE=3 SV=1 9 377 2.0E-58
sp|Q8E9N3|LEU3_SHEON 3-isopropylmalate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=leuB PE=1 SV=1 7 372 2.0E-58
sp|Q5E857|LEU3_VIBF1 3-isopropylmalate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuB PE=3 SV=1 4 362 2.0E-58
sp|Q8ZIG9|LEU3_YERPE 3-isopropylmalate dehydrogenase OS=Yersinia pestis GN=leuB PE=3 SV=2 4 357 2.0E-58
sp|O66607|LEU3_AQUAE 3-isopropylmalate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=leuB PE=3 SV=1 5 348 4.0E-58
sp|Q65V05|LEU3_MANSM 3-isopropylmalate dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuB PE=3 SV=1 7 372 4.0E-58
sp|Q66EM2|LEU3_YERPS 3-isopropylmalate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuB PE=3 SV=2 4 357 5.0E-58
sp|P05645|LEU3_BACSU 3-isopropylmalate dehydrogenase OS=Bacillus subtilis (strain 168) GN=leuB PE=3 SV=3 9 368 7.0E-58
sp|Q02143|LEU3_LACLA 3-isopropylmalate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuB PE=3 SV=3 9 370 8.0E-58
sp|Q8X9Z9|LEU3_ECO57 3-isopropylmalate dehydrogenase OS=Escherichia coli O157:H7 GN=leuB PE=3 SV=3 4 355 1.0E-57
sp|Q8FL76|LEU3_ECOL6 3-isopropylmalate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuB PE=3 SV=3 4 355 1.0E-57
sp|Q1RGC4|LEU3_ECOUT 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuB PE=3 SV=1 4 355 2.0E-57
sp|Q87SS8|LEU3_VIBPA 3-isopropylmalate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuB PE=3 SV=1 5 362 2.0E-57
sp|P61495|LEU3_THETH 3-isopropylmalate dehydrogenase OS=Thermus thermophilus GN=leuB PE=1 SV=2 9 373 2.0E-57
sp|Q5SIY4|LEU3_THET8 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuB PE=1 SV=1 9 373 3.0E-57
sp|Q7NFH4|LEU3_GLOVI 3-isopropylmalate dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuB PE=3 SV=1 7 371 3.0E-57
sp|P30125|LEU3_ECOLI 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain K12) GN=leuB PE=1 SV=3 4 355 3.0E-57
sp|P61494|LEU3_THET2 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuB PE=3 SV=1 9 373 5.0E-57
sp|Q83SP1|LEU3_SHIFL 3-isopropylmalate dehydrogenase OS=Shigella flexneri GN=leuB PE=3 SV=3 4 355 6.0E-57
sp|Q3Z5T7|LEU3_SHISS 3-isopropylmalate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=leuB PE=3 SV=2 4 355 7.0E-57
sp|Q4L7U1|LEU3_STAHJ 3-isopropylmalate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuB PE=3 SV=1 7 343 7.0E-57
sp|Q32K21|LEU3_SHIDS 3-isopropylmalate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuB PE=3 SV=2 4 355 7.0E-57
sp|Q2NVW4|LEU3_SODGM 3-isopropylmalate dehydrogenase OS=Sodalis glossinidius (strain morsitans) GN=leuB PE=3 SV=1 4 365 1.0E-56
sp|Q9KP82|LEU3_VIBCH 3-isopropylmalate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuB PE=3 SV=1 5 372 1.0E-56
sp|Q7U840|LEU3_SYNPX 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain WH8102) GN=leuB PE=3 SV=1 7 348 1.0E-56
sp|Q3B595|LEU3_CHLL7 3-isopropylmalate dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=leuB PE=3 SV=1 6 362 1.0E-56
sp|P43860|LEU3_HAEIN 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuB PE=3 SV=1 7 364 2.0E-56
sp|P37412|LEU3_SALTY 3-isopropylmalate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuB PE=1 SV=2 4 355 2.0E-56
sp|Q57TE7|LEU3_SALCH 3-isopropylmalate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=leuB PE=3 SV=1 4 355 2.0E-56
sp|Q326G2|LEU3_SHIBS 3-isopropylmalate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuB PE=3 SV=2 4 355 2.0E-56
sp|Q4QLS3|LEU3_HAEI8 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=leuB PE=3 SV=1 7 364 3.0E-56
sp|Q6LV25|LEU3_PHOPR 3-isopropylmalate dehydrogenase OS=Photobacterium profundum GN=leuB PE=3 SV=1 7 357 6.0E-56
sp|Q8EN68|LEU3_OCEIH 3-isopropylmalate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuB PE=3 SV=1 9 370 6.0E-56
sp|Q7MP78|LEU3_VIBVY 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=leuB PE=3 SV=1 5 357 6.0E-56
sp|Q2JL30|LEU3_SYNJB 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuB PE=3 SV=1 4 361 9.0E-56
sp|Q8RDK0|LEU3_CALS4 3-isopropylmalate dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuB PE=3 SV=1 6 362 9.0E-56
sp|Q8DEE0|LEU3_VIBVU 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=leuB PE=3 SV=1 5 357 1.0E-55
sp|P05644|LEU3_BACCA 3-isopropylmalate dehydrogenase OS=Bacillus caldotenax GN=leuB PE=3 SV=1 7 316 1.0E-55
sp|Q5PDG2|LEU3_SALPA 3-isopropylmalate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuB PE=3 SV=1 4 355 3.0E-55
sp|Q8Z9I1|LEU3_SALTI 3-isopropylmalate dehydrogenase OS=Salmonella typhi GN=leuB PE=3 SV=1 4 355 4.0E-55
sp|Q65GI9|LEU3_BACLD 3-isopropylmalate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuB PE=3 SV=2 9 348 5.0E-55
sp|Q49Z13|LEU3_STAS1 3-isopropylmalate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuB PE=3 SV=1 7 343 9.0E-55
sp|Q8DTG3|LEU3_STRMU 3-isopropylmalate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuB PE=3 SV=1 6 368 1.0E-54
sp|Q3KF21|LEU3_PSEPF 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=leuB PE=3 SV=1 9 375 2.0E-54
sp|Q9WZ26|LEU3_THEMA 3-isopropylmalate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuB PE=1 SV=1 9 343 2.0E-54
sp|Q2FWK2|LEU3_STAA8 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=leuB PE=3 SV=1 7 356 4.0E-54
sp|Q7UIE1|LEU3_RHOBA 3-isopropylmalate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuB PE=3 SV=2 8 374 5.0E-54
sp|Q6D0G7|LEU3_PECAS 3-isopropylmalate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuB PE=3 SV=1 4 339 5.0E-54
sp|Q4KF05|LEU3_PSEF5 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuB PE=3 SV=1 9 375 6.0E-54
sp|Q606F4|LEU3_METCA 3-isopropylmalate dehydrogenase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuB PE=3 SV=1 9 372 6.0E-54
sp|Q5HEE3|LEU3_STAAC 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=leuB PE=3 SV=1 7 356 6.0E-54
sp|Q2FF66|LEU3_STAA3 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=leuB PE=3 SV=1 7 356 6.0E-54
sp|Q7M886|LEU3_WOLSU 3-isopropylmalate dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuB PE=3 SV=1 5 358 7.0E-54
sp|Q2RGA0|LEU3_MOOTA 3-isopropylmalate dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=leuB PE=3 SV=1 6 362 8.0E-54
sp|Q58991|AKSF_METJA Homoisocitrate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aksF PE=1 SV=3 6 368 8.0E-54
sp|Q48K97|LEU3_PSE14 3-isopropylmalate dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuB PE=3 SV=1 9 372 1.0E-53
sp|Q2JTN8|LEU3_SYNJA 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuB PE=3 SV=1 4 352 1.0E-53
sp|Q6G7Q0|LEU3_STAAS 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=leuB PE=3 SV=1 7 356 2.0E-53
sp|P65101|LEU3_STAAN 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=leuB PE=3 SV=1 7 356 2.0E-53
sp|P65100|LEU3_STAAM 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuB PE=3 SV=1 7 356 2.0E-53
sp|Q5NPQ9|LEU3_ZYMMO 3-isopropylmalate dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuB PE=3 SV=1 9 372 2.0E-53
sp|Q6GF15|LEU3_STAAR 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=leuB PE=3 SV=1 7 356 2.0E-53
sp|Q8NVJ0|LEU3_STAAW 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=leuB PE=3 SV=1 7 356 4.0E-53
sp|Q5FUG5|LEU3_GLUOX 3-isopropylmalate dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=leuB PE=3 SV=1 7 368 4.0E-53
sp|Q9SA14|LEU31_ARATH 3-isopropylmalate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=IMDH1 PE=2 SV=2 5 353 5.0E-53
sp|Q2YUF1|LEU3_STAAB 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuB PE=3 SV=1 7 356 5.0E-53
sp|P59029|LEU3_THEEB 3-isopropylmalate dehydrogenase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuB PE=3 SV=1 7 348 6.0E-53
sp|Q3A3B2|LEU3_PELCD 3-isopropylmalate dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=leuB PE=3 SV=1 7 339 8.0E-53
sp|P73960|LEU3_SYNY3 3-isopropylmalate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuB PE=3 SV=1 4 353 9.0E-53
sp|Q31HI0|LEU3_THICR 3-isopropylmalate dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=leuB PE=3 SV=1 9 372 1.0E-52
sp|Q97EE2|LEU3_CLOAB 3-isopropylmalate dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuB PE=3 SV=1 7 362 1.0E-52
sp|Q4ZUZ4|LEU3_PSEU2 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuB PE=3 SV=1 9 372 1.0E-52
sp|Q3AYS1|LEU3_SYNS9 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9902) GN=leuB PE=3 SV=1 7 348 1.0E-52
sp|Q21IY5|LEU3_SACD2 3-isopropylmalate dehydrogenase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuB PE=3 SV=1 9 318 2.0E-52
sp|Q9FMT1|LEU33_ARATH 3-isopropylmalate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=IMDH3 PE=1 SV=1 5 353 2.0E-52
sp|Q3APC4|LEU3_CHLCH 3-isopropylmalate dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=leuB PE=3 SV=1 7 349 3.0E-52
sp|Q884C0|LEU3_PSESM 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuB PE=3 SV=1 9 372 4.0E-52
sp|Q8YXA2|LEU3_NOSS1 3-isopropylmalate dehydrogenase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuB PE=3 SV=1 4 373 4.0E-52
sp|P59028|LEU3_CHLTE 3-isopropylmalate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=leuB PE=3 SV=1 6 370 4.0E-52
sp|P29102|LEU3_BRANA 3-isopropylmalate dehydrogenase, chloroplastic OS=Brassica napus PE=2 SV=1 5 339 5.0E-52
sp|Q7VH33|LEU3_HELHP 3-isopropylmalate dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuB PE=3 SV=2 9 355 7.0E-52
sp|Q88LE5|LEU3_PSEPK 3-isopropylmalate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=leuB PE=3 SV=1 9 375 8.0E-52
sp|Q3BPJ8|LEU3_XANC5 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuB PE=3 SV=1 9 362 9.0E-52
sp|Q51375|LEU3_PSEAE 3-isopropylmalate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuB PE=3 SV=2 9 375 9.0E-52
sp|P93832|LEU32_ARATH 3-isopropylmalate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=IMDH2 PE=1 SV=1 5 339 1.0E-51
sp|Q5M405|LEU3_STRT2 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuB PE=3 SV=2 9 368 1.0E-51
sp|Q5LZF3|LEU3_STRT1 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuB PE=3 SV=2 9 368 1.0E-51
sp|P40495|LYS12_YEAST Homoisocitrate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS12 PE=1 SV=1 8 362 2.0E-51
sp|Q5H4C7|LEU3_XANOR 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuB PE=3 SV=1 9 362 2.0E-51
sp|Q2P762|LEU3_XANOM 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuB PE=3 SV=1 9 362 2.0E-51
sp|Q3M8T9|LEU3_ANAVT 3-isopropylmalate dehydrogenase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuB PE=3 SV=1 4 355 3.0E-51
sp|Q39Y29|LEU3_GEOMG 3-isopropylmalate dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuB PE=3 SV=1 4 339 4.0E-51
sp|Q748X2|LEU3_GEOSL 3-isopropylmalate dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuB PE=3 SV=1 4 339 5.0E-51
sp|Q2IJK7|LEU3_ANADE 3-isopropylmalate dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuB PE=3 SV=1 9 347 6.0E-51
sp|Q2G4X5|LEU3_NOVAD 3-isopropylmalate dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuB PE=3 SV=2 9 368 1.0E-50
sp|O14104|LYS12_SCHPO Homoisocitrate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys12 PE=1 SV=1 1 362 1.0E-50
sp|P12010|LEU3_BACCO 3-isopropylmalate dehydrogenase OS=Bacillus coagulans GN=leuB PE=1 SV=1 9 339 2.0E-50
sp|Q3AIH4|LEU3_SYNSC 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9605) GN=leuB PE=3 SV=1 7 316 3.0E-50
sp|Q8PH05|LEU3_XANAC 3-isopropylmalate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuB PE=3 SV=1 9 362 3.0E-50
sp|Q21XI1|LEU3_RHOFT 3-isopropylmalate dehydrogenase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuB PE=3 SV=1 9 372 4.0E-50
sp|O31292|LEU3_BUCTS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuB PE=3 SV=1 5 318 5.0E-50
sp|Q2SJD6|LEU3_HAHCH 3-isopropylmalate dehydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=leuB PE=3 SV=1 9 373 5.0E-50
sp|Q7V1R9|LEU3_PROMP 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuB PE=3 SV=1 5 344 1.0E-49
sp|Q31B91|LEU3_PROM9 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuB PE=3 SV=1 7 339 1.0E-49
sp|Q9EVH5|LEU3_BUCUE 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuB PE=3 SV=1 5 339 1.0E-49
sp|Q7NUC2|LEU3_CHRVO 3-isopropylmalate dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuB PE=3 SV=1 9 339 2.0E-49
sp|Q8XXX5|LEU3_RALSO 3-isopropylmalate dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=leuB PE=3 SV=2 6 372 2.0E-49
sp|Q5WEN4|LEU3_BACSK 3-isopropylmalate dehydrogenase OS=Bacillus clausii (strain KSM-K16) GN=leuB PE=3 SV=1 9 339 3.0E-49
sp|Q9PLW0|LEU3_CAMJE 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuB PE=1 SV=1 5 364 5.0E-49
sp|Q5LWZ5|LEU3_RUEPO 3-isopropylmalate dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuB PE=3 SV=1 8 368 7.0E-49
sp|Q8DPJ4|LEU3_STRR6 3-isopropylmalate dehydrogenase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=leuB PE=3 SV=1 9 368 8.0E-49
sp|Q30RK2|LEU3_SULDN 3-isopropylmalate dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuB PE=3 SV=1 5 368 1.0E-48
sp|Q30WD0|LEU3_DESAG 3-isopropylmalate dehydrogenase OS=Desulfovibrio alaskensis (strain G20) GN=leuB PE=3 SV=1 9 339 2.0E-48
sp|Q47WG3|LEU3_COLP3 3-isopropylmalate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuB PE=3 SV=1 6 356 2.0E-48
sp|Q5HMF8|LEU3_STAEQ 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuB PE=3 SV=1 7 342 2.0E-48
sp|P59515|LEU3_BUCBP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuB PE=3 SV=1 5 370 3.0E-48
sp|Q8CNL2|LEU3_STAES 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuB PE=3 SV=1 7 342 3.0E-48
sp|Q89XA0|LEU31_BRADU 3-isopropylmalate dehydrogenase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB1 PE=3 SV=2 8 339 3.0E-48
sp|Q46YW0|LEU3_CUPPJ 3-isopropylmalate dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuB PE=3 SV=1 9 372 3.0E-48
sp|Q5MZ40|LEU3_SYNP6 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuB PE=3 SV=2 4 374 4.0E-48
sp|Q31N34|LEU3_SYNE7 3-isopropylmalate dehydrogenase OS=Synechococcus elongatus (strain PCC 7942) GN=leuB PE=3 SV=1 4 374 4.0E-48
sp|Q24XT2|LEU3_DESHY 3-isopropylmalate dehydrogenase OS=Desulfitobacterium hafniense (strain Y51) GN=leuB PE=3 SV=1 9 349 5.0E-48
sp|O85071|LEU3_BUCDN 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuB PE=3 SV=1 5 342 2.0E-47
sp|Q5HS77|LEU3_CAMJR 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni (strain RM1221) GN=leuB PE=3 SV=1 5 364 2.0E-47
sp|O85064|LEU3_BUCAP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuB PE=3 SV=1 7 339 2.0E-47
sp|Q9JZI9|LEU3_NEIMB 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuB PE=3 SV=1 9 352 3.0E-47
sp|Q3ZXI7|LEU3_DEHMC 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuB PE=3 SV=1 7 339 4.0E-47
sp|P56933|LEU3_BUCAI 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuB PE=3 SV=2 7 364 4.0E-47
sp|Q8P5L1|LEU3_XANCP 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuB PE=3 SV=1 9 372 6.0E-47
sp|Q4UYG2|LEU3_XANC8 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuB PE=3 SV=1 9 372 6.0E-47
sp|Q7VC80|LEU3_PROMA 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuB PE=3 SV=1 7 339 6.0E-47
sp|Q9JU79|LEU3_NEIMA 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuB PE=3 SV=1 9 339 9.0E-47
sp|Q28480|IDH3A_MACFA Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3A PE=2 SV=2 6 340 1.0E-46
sp|Q1LKH7|LEU3_CUPMC 3-isopropylmalate dehydrogenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuB PE=3 SV=1 9 372 1.0E-46
sp|P33197|IDH_THET8 Isocitrate dehydrogenase [NADP] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=icd PE=1 SV=2 9 369 1.0E-46
sp|Q9EVG3|LEU3_BUCML 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuB PE=3 SV=1 5 339 1.0E-46
sp|Q9EVH8|LEU3_BUCUH 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuB PE=3 SV=1 7 357 1.0E-46
sp|Q2KYL5|LEU3_BORA1 3-isopropylmalate dehydrogenase OS=Bordetella avium (strain 197N) GN=leuB PE=3 SV=1 9 373 1.0E-46
sp|Q9ZDR0|IDH_RICPR Isocitrate dehydrogenase [NADP] OS=Rickettsia prowazekii (strain Madrid E) GN=icd PE=3 SV=1 9 339 1.0E-46
sp|Q8Y5R8|LEU3_LISMO 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuB PE=3 SV=1 7 372 2.0E-46
sp|Q12545|LEU3_ACRCH 3-isopropylmalate dehydrogenase OS=Acremonium chrysogenum GN=LEU2 PE=3 SV=1 4 368 2.0E-46
sp|Q9PAX3|LEU3_XYLFA 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain 9a5c) GN=leuB PE=3 SV=1 9 348 2.0E-46
sp|Q393X4|LEU3_BURL3 3-isopropylmalate dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuB PE=3 SV=1 9 372 2.0E-46
sp|Q98E57|LEU3_RHILO 3-isopropylmalate dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=leuB PE=3 SV=1 11 368 3.0E-46
sp|Q2Y7Q8|LEU3_NITMU 3-isopropylmalate dehydrogenase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuB PE=3 SV=1 9 361 4.0E-46
sp|Q1QUR0|LEU3_CHRSD 3-isopropylmalate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=leuB PE=3 SV=2 9 339 4.0E-46
sp|O59394|HICD_PYRHO Isocitrate--homoisocitrate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1722 PE=1 SV=2 6 361 4.0E-46
sp|Q71Y34|LEU3_LISMF 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuB PE=3 SV=1 7 372 6.0E-46
sp|P59027|LEU3_BUCPS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuB PE=3 SV=1 4 318 6.0E-46
sp|P48572|LEU3_BUCRP 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuB PE=3 SV=1 7 339 7.0E-46
sp|Q726X1|LEU3_DESVH 3-isopropylmalate dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuB PE=3 SV=1 8 339 8.0E-46
sp|Q2S0M8|LEU3_SALRD 3-isopropylmalate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuB PE=3 SV=2 1 339 9.0E-46
sp|Q9RTH9|LEU3_DEIRA 3-isopropylmalate dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuB PE=3 SV=1 9 352 1.0E-45
sp|Q87BQ1|LEU3_XYLFT 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuB PE=3 SV=1 9 348 1.0E-45
sp|Q7W929|LEU3_BORPA 3-isopropylmalate dehydrogenase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuB PE=3 SV=2 7 372 1.0E-45
sp|Q7WKH4|LEU32_BORBR 3-isopropylmalate dehydrogenase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB2 PE=3 SV=1 7 372 1.0E-45
sp|Q479H7|LEU32_DECAR 3-isopropylmalate dehydrogenase 2 OS=Dechloromonas aromatica (strain RCB) GN=leuB2 PE=3 SV=1 9 375 2.0E-45
sp|Q5R678|IDH3A_PONAB Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Pongo abelii GN=IDH3A PE=2 SV=1 6 340 2.0E-45
sp|P50213|IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens GN=IDH3A PE=1 SV=1 6 340 2.0E-45
sp|Q9EVI1|LEU3_BUCUO 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuB PE=3 SV=1 7 364 2.0E-45
sp|Q9EVG6|LEU3_BUCUA 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuB PE=3 SV=1 4 364 2.0E-45
sp|Q63JL2|LEU3_BURPS 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=leuB PE=3 SV=1 9 372 3.0E-45
sp|Q3JKG9|LEU3_BURP1 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=leuB PE=3 SV=1 9 372 3.0E-45
sp|Q62AI9|LEU3_BURMA 3-isopropylmalate dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=leuB PE=3 SV=1 9 372 3.0E-45
sp|Q845W3|LEU3_BURM1 3-isopropylmalate dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuB PE=3 SV=1 9 372 3.0E-45
sp|Q6FEV6|LEU3_ACIAD 3-isopropylmalate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuB PE=3 SV=1 9 373 4.0E-45
sp|Q5WPZ9|LEU3_BUCCC 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuB PE=3 SV=1 1 368 4.0E-45
sp|Q3Z896|LEU3_DEHM1 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=leuB PE=3 SV=1 7 339 4.0E-45
sp|Q1RJU4|IDH_RICBR Isocitrate dehydrogenase [NADP] OS=Rickettsia bellii (strain RML369-C) GN=icd PE=3 SV=1 9 339 4.0E-45
sp|Q9EVG9|LEU3_BUCUM 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuB PE=3 SV=1 7 357 4.0E-45
sp|Q5F8T6|LEU3_NEIG1 3-isopropylmalate dehydrogenase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuB PE=3 SV=1 9 339 5.0E-45
sp|Q2T7H6|LEU3_BURTA 3-isopropylmalate dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuB PE=1 SV=1 9 372 5.0E-45
sp|Q9D6R2|IDH3A_MOUSE Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus GN=Idh3a PE=1 SV=1 6 340 5.0E-45
sp|Q1IZK2|LEU3_DEIGD 3-isopropylmalate dehydrogenase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuB PE=3 SV=1 9 352 6.0E-45
sp|Q5P1J6|LEU3_AROAE 3-isopropylmalate dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=leuB PE=3 SV=1 9 372 6.0E-45
sp|Q92A27|LEU3_LISIN 3-isopropylmalate dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuB PE=3 SV=1 7 305 8.0E-45
sp|Q6ND82|LEU3_RHOPA 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuB PE=3 SV=1 7 348 9.0E-45
sp|Q47HR1|LEU31_DECAR 3-isopropylmalate dehydrogenase 1 OS=Dechloromonas aromatica (strain RCB) GN=leuB1 PE=3 SV=1 9 339 1.0E-44
sp|Q81G11|LEU3_BACCR 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuB PE=3 SV=1 9 368 1.0E-44
sp|Q945K7|IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana GN=IDH5 PE=2 SV=1 8 368 1.0E-44
sp|P41563|IDH3A_BOVIN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Bos taurus GN=IDH3A PE=1 SV=1 8 340 2.0E-44
sp|Q68XA5|IDH_RICTY Isocitrate dehydrogenase [NADP] OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=icd PE=3 SV=1 9 339 2.0E-44
sp|Q9ABN3|LEU3_CAUCR 3-isopropylmalate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuB PE=3 SV=1 6 372 3.0E-44
sp|Q63DX7|LEU3_BACCZ 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=leuB PE=3 SV=1 9 368 3.0E-44
sp|Q9USP8|IDH2_SCHPO Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh2 PE=1 SV=2 7 348 3.0E-44
sp|Q4UKR1|IDH_RICFE Isocitrate dehydrogenase [NADP] OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=icd PE=3 SV=2 9 339 3.0E-44
sp|Q3IZJ3|LEU3_RHOS4 3-isopropylmalate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuB PE=3 SV=2 8 372 4.0E-44
sp|Q6HLF2|LEU3_BACHK 3-isopropylmalate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuB PE=3 SV=1 9 368 5.0E-44
sp|Q7VY73|LEU3_BORPE 3-isopropylmalate dehydrogenase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuB PE=3 SV=1 7 372 5.0E-44
sp|Q7VQJ7|LEU3_BLOFL 3-isopropylmalate dehydrogenase OS=Blochmannia floridanus GN=leuB PE=3 SV=1 7 343 6.0E-44
sp|Q2J3B4|LEU3_RHOP2 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuB PE=3 SV=1 7 348 6.0E-44
sp|Q89X19|LEU32_BRADU 3-isopropylmalate dehydrogenase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB2 PE=3 SV=1 7 375 9.0E-44
sp|Q73B99|LEU3_BACC1 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuB PE=3 SV=1 9 368 9.0E-44
sp|Q99NA5|IDH3A_RAT Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Idh3a PE=1 SV=1 6 340 1.0E-43
sp|Q3JCC4|LEU3_NITOC 3-isopropylmalate dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuB PE=3 SV=1 9 362 2.0E-43
sp|Q28W67|LEU3_JANSC 3-isopropylmalate dehydrogenase OS=Jannaschia sp. (strain CCS1) GN=leuB PE=3 SV=1 8 374 3.0E-43
sp|Q9EVE1|LEU3_BUCUD 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon rudbeckiae GN=leuB PE=3 SV=1 5 357 4.0E-43
sp|Q82WI6|LEU3_NITEU 3-isopropylmalate dehydrogenase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuB PE=3 SV=1 9 362 4.0E-43
sp|Q92IR7|IDH_RICCN Isocitrate dehydrogenase [NADP] OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=icd PE=3 SV=1 9 339 6.0E-43
sp|Q81T67|LEU3_BACAN 3-isopropylmalate dehydrogenase OS=Bacillus anthracis GN=leuB PE=3 SV=1 9 368 7.0E-43
sp|P24404|LEU3_AGRFC 3-isopropylmalate dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuB PE=3 SV=2 8 348 7.0E-43
sp|Q21CS1|LEU3_RHOPB 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuB PE=3 SV=2 7 375 8.0E-43
sp|Q55BI2|IDHA_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit A, mitochondrial OS=Dictyostelium discoideum GN=idhA PE=3 SV=1 4 340 1.0E-42
sp|P50455|LEU3_SULTO 3-isopropylmalate dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuB PE=1 SV=3 7 364 1.0E-42
sp|P24015|LEU3_LEPIN 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuB PE=3 SV=1 6 343 2.0E-42
sp|Q72RH7|LEU3_LEPIC 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuB PE=3 SV=1 6 343 2.0E-42
sp|Q7WNM3|LEU31_BORBR 3-isopropylmalate dehydrogenase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB1 PE=3 SV=1 2 339 2.0E-42
sp|O59930|LEU3_PHACH 3-isopropylmalate dehydrogenase OS=Phanerochaete chrysosporium GN=LEU2 PE=2 SV=1 5 365 2.0E-42
sp|D4GYE8|LEU3_HALVD 3-isopropylmalate dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuB PE=3 SV=1 9 368 2.0E-42
sp|P50180|LEU3_NEILA 3-isopropylmalate dehydrogenase (Fragment) OS=Neisseria lactamica GN=leuB PE=3 SV=1 9 318 3.0E-42
sp|P31958|LEU3_CLOPA 3-isopropylmalate dehydrogenase OS=Clostridium pasteurianum GN=leuB PE=3 SV=1 7 339 3.0E-42
sp|Q4FRV0|LEU3_PSYA2 3-isopropylmalate dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuB PE=3 SV=1 6 339 5.0E-42
sp|Q3SNU3|LEU3_NITWN 3-isopropylmalate dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuB PE=3 SV=1 7 375 5.0E-42
sp|Q56268|LEU3_ACIFR 3-isopropylmalate dehydrogenase OS=Acidithiobacillus ferrooxidans GN=leuB PE=1 SV=1 6 372 6.0E-42
sp|Q8YCX4|LEU3_BRUME 3-isopropylmalate dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuB PE=3 SV=1 9 368 7.0E-42
sp|Q8LG77|IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana GN=IDH6 PE=2 SV=2 11 368 8.0E-42
sp|Q54B68|IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum GN=idhB PE=3 SV=1 8 368 1.0E-41
sp|Q9EVI7|LEU3_BUCUN 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuB PE=3 SV=1 5 364 1.0E-41
sp|Q9VWH4|IDH3A_DROME Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=l(1)G0156 PE=2 SV=1 9 340 4.0E-41
sp|Q3SHL3|LEU3_THIDA 3-isopropylmalate dehydrogenase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuB PE=3 SV=1 9 339 4.0E-41
sp|Q8FVF3|LEU3_BRUSU 3-isopropylmalate dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=leuB PE=3 SV=1 9 368 4.0E-41
sp|Q493R1|LEU3_BLOPB 3-isopropylmalate dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuB PE=3 SV=1 7 339 9.0E-41
sp|Q93714|IDH3A_CAEEL Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=idha-1 PE=3 SV=3 9 368 1.0E-40
sp|Q579B1|LEU3_BRUAB 3-isopropylmalate dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=leuB PE=3 SV=1 9 368 1.0E-40
sp|Q2YL58|LEU3_BRUA2 3-isopropylmalate dehydrogenase OS=Brucella abortus (strain 2308) GN=leuB PE=3 SV=1 9 368 1.0E-40
sp|Q1QAF5|LEU3_PSYCK 3-isopropylmalate dehydrogenase OS=Psychrobacter cryohalolentis (strain K5) GN=leuB PE=3 SV=1 6 318 1.0E-40
sp|Q48806|DLPA_LEGPH Protein DlpA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dlpA PE=3 SV=1 1 368 3.0E-40
sp|Q8A6M0|LEU3_BACTN 3-isopropylmalate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuB PE=3 SV=1 7 339 3.0E-40
sp|P34733|LEU3_PICAN 3-isopropylmalate dehydrogenase OS=Pichia angusta GN=LEU2 PE=3 SV=1 8 375 4.0E-40
sp|Q9UXB2|LEU3_SULSO 3-isopropylmalate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuB PE=3 SV=1 7 370 4.0E-40
sp|Q9EVI4|LEU3_BUCUS 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuB PE=3 SV=1 7 364 4.0E-40
sp|Q1MA50|LEU3_RHIL3 3-isopropylmalate dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuB PE=3 SV=1 11 375 6.0E-40
sp|Q2K2V0|LEU3_RHIEC 3-isopropylmalate dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuB PE=3 SV=1 11 368 7.0E-40
sp|P29696|LEU3_SOLTU 3-isopropylmalate dehydrogenase, chloroplastic OS=Solanum tuberosum PE=2 SV=1 4 340 2.0E-39
sp|Q00412|LEU3_ARTPT 3-isopropylmalate dehydrogenase OS=Arthrospira platensis GN=leuB PE=3 SV=1 4 359 2.0E-39
sp|P28241|IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH2 PE=1 SV=1 7 370 8.0E-39
sp|Q2VZV2|LEU3_MAGSA 3-isopropylmalate dehydrogenase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuB PE=3 SV=1 9 361 9.0E-39
sp|Q92KY8|LEU3_RHIME 3-isopropylmalate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=leuB PE=3 SV=1 11 368 1.0E-38
sp|P54354|LEU3_BACFR 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=leuB PE=3 SV=1 7 348 2.0E-38
sp|Q5LAB4|LEU3_BACFN 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuB PE=3 SV=1 7 348 2.0E-38
sp|O14429|LEU3_CANGA 3-isopropylmalate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LEU2 PE=3 SV=2 8 372 2.0E-37
sp|P41926|LEU3_KODOH 3-isopropylmalate dehydrogenase OS=Kodamaea ohmeri GN=LEU2 PE=3 SV=1 8 375 6.0E-37
sp|O94230|IDH2_KLULA Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH2 PE=3 SV=1 3 368 1.0E-36
sp|O94229|IDH1_KLULA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 7 370 1.0E-36
sp|P18869|LEU3_SCHPO 3-isopropylmalate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu1 PE=1 SV=1 9 375 2.0E-36
sp|Q6TWC4|LEU3_SORMA 3-isopropylmalate dehydrogenase OS=Sordaria macrospora GN=LEU1 PE=3 SV=1 7 368 2.0E-36
sp|O94114|LEU3_PICST 3-isopropylmalate dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LEU2 PE=3 SV=3 4 375 3.0E-36
sp|P96197|LEU3_AZOVI 3-isopropylmalate dehydrogenase OS=Azotobacter vinelandii GN=leuB PE=3 SV=1 9 375 4.0E-36
sp|O60027|LEU3_ASHGO 3-isopropylmalate dehydrogenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU2 PE=3 SV=1 9 372 4.0E-36
sp|Q4FP17|LEU3_PELUB 3-isopropylmalate dehydrogenase OS=Pelagibacter ubique (strain HTCC1062) GN=leuB PE=3 SV=1 1 374 4.0E-36
sp|Q9HDQ1|LEU3_WICAO 3-isopropylmalate dehydrogenase OS=Wickerhamomyces anomalus GN=LEU2 PE=3 SV=1 8 376 4.0E-36
sp|Q96WT9|LEU3_SACEX 3-isopropylmalate dehydrogenase OS=Saccharomyces exiguus GN=LEU2 PE=3 SV=1 9 375 5.0E-36
sp|P34738|LEU3_NEUCR 3-isopropylmalate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-1 PE=3 SV=2 7 368 1.0E-35
sp|Q9P3Y0|LEU3_ZYGBA 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces bailii GN=LEU2 PE=3 SV=1 8 375 2.0E-35
sp|Q6PY58|LEU3_CANHU 3-isopropylmalate dehydrogenase OS=Candida humilis GN=LEU2 PE=3 SV=1 8 372 2.0E-35
sp|Q2RV53|LEU3_RHORT 3-isopropylmalate dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuB PE=3 SV=1 9 375 2.0E-35
sp|P87257|LEU3B_ASPNG 3-isopropylmalate dehydrogenase B OS=Aspergillus niger GN=leu2B PE=2 SV=1 1 372 4.0E-35
sp|P08791|LEU3_CYBJA 3-isopropylmalate dehydrogenase OS=Cyberlindnera jadinii GN=LEU2 PE=3 SV=1 8 375 5.0E-35
sp|Q9Y897|LEU3_ZYMTR 3-isopropylmalate dehydrogenase OS=Zymoseptoria tritici GN=LEUC PE=3 SV=1 7 375 5.0E-35
sp|P04173|LEU3_YEAST 3-isopropylmalate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU2 PE=1 SV=4 9 375 7.0E-35
sp|P23390|LEU3_KLULA 3-isopropylmalate dehydrogenase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LEU2 PE=3 SV=2 8 375 1.0E-34
sp|Q96WI0|LEU3_ZYGRC 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LEU2 PE=3 SV=1 8 375 1.0E-34
sp|P41766|LEU3_KLUMA 3-isopropylmalate dehydrogenase OS=Kluyveromyces marxianus GN=LEU2 PE=3 SV=1 8 375 3.0E-34
sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=idhb-1 PE=3 SV=1 2 368 6.0E-34
sp|P87256|LEU3A_ASPNG 3-isopropylmalate dehydrogenase A OS=Aspergillus niger GN=leu2A PE=2 SV=1 7 368 8.0E-34
sp|P07139|LEU3_CANMA 3-isopropylmalate dehydrogenase OS=Candida maltosa GN=LEU2 PE=3 SV=1 5 375 9.0E-34
sp|Q9HDQ5|LEU3_CANRU 3-isopropylmalate dehydrogenase OS=Candida rugosa GN=LEU2 PE=3 SV=1 8 372 1.0E-33
sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 7 375 1.0E-32
sp|O13302|IDH1_AJECA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 7 368 1.0E-32
sp|Q6B458|LEU3_DEBHA 3-isopropylmalate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LEU2 PE=3 SV=1 8 375 2.0E-32
sp|P87186|LEU3_CANAX 3-isopropylmalate dehydrogenase OS=Candida albicans GN=LEU2 PE=3 SV=1 5 375 9.0E-32
sp|D4GU92|IDH_HALVD Isocitrate dehydrogenase [NADP] OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=icd PE=1 SV=1 9 354 3.0E-31
sp|O13696|IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 7 368 1.0E-30
sp|Q59985|IDH_STRSL Isocitrate dehydrogenase [NADP] OS=Streptococcus salivarius GN=icd PE=3 SV=1 9 355 1.0E-30
sp|P70404|IDHG1_MOUSE Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus GN=Idh3g PE=1 SV=1 7 377 4.0E-30
sp|P41565|IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus GN=Idh3g PE=1 SV=2 7 377 5.0E-30
sp|P93032|IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana GN=IDH2 PE=2 SV=2 9 362 8.0E-30
sp|Q8LFC0|IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana GN=IDH1 PE=2 SV=2 9 362 1.0E-29
sp|P18120|LEU3_YARLI 3-isopropylmalate dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LEU2 PE=3 SV=2 9 365 2.0E-29
sp|P51553|IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens GN=IDH3G PE=1 SV=1 7 377 2.0E-29
sp|P41564|IDH3G_MACFA Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3G PE=2 SV=1 7 377 3.0E-29
sp|Q58CP0|IDH3G_BOVIN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Bos taurus GN=IDH3G PE=2 SV=1 7 377 5.0E-29
sp|O29610|IDH_ARCFU Isocitrate dehydrogenase [NADP] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=icd PE=1 SV=1 9 339 5.0E-29
sp|P39126|IDH_BACSU Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) GN=icd PE=1 SV=1 9 336 6.0E-29
sp|O81796|IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana GN=IDH3 PE=1 SV=1 8 356 1.0E-28
sp|Q59940|IDH_STRMU Isocitrate dehydrogenase [NADP] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=icd PE=3 SV=2 8 340 2.0E-28
sp|Q01987|LEU3_CANBO 3-isopropylmalate dehydrogenase OS=Candida boidinii GN=LEU2 PE=3 SV=1 9 372 4.0E-28
sp|Q8NKB8|LEU3_BLAAD 3-isopropylmalate dehydrogenase OS=Blastobotrys adeninivorans GN=LEU2 PE=3 SV=1 8 368 4.0E-27
sp|P08200|IDH_ECOLI Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) GN=icd PE=1 SV=1 9 333 5.0E-27
sp|O77784|IDH3B_BOVIN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 7 319 7.0E-27
sp|Q9ZN36|IDH_HELPJ Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=icd PE=3 SV=1 9 340 9.0E-27
sp|Q28479|IDH3B_MACFA Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Macaca fascicularis GN=IDH3B PE=2 SV=2 7 319 3.0E-26
sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 7 319 4.0E-26
sp|P56063|IDH_HELPY Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=icd PE=3 SV=1 9 340 6.0E-26
sp|Q68FX0|IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=2 SV=1 7 319 8.0E-26
sp|O67480|IDH_AQUAE Isocitrate dehydrogenase [NADP] OS=Aquifex aeolicus (strain VF5) GN=icd PE=3 SV=1 9 376 1.0E-25
sp|Q8NW61|IDH_STAAW Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MW2) GN=icd PE=3 SV=1 9 336 2.0E-25
sp|Q6G8N2|IDH_STAAS Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MSSA476) GN=icd PE=3 SV=1 9 336 2.0E-25
sp|Q6GG12|IDH_STAAR Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MRSA252) GN=icd PE=3 SV=1 9 336 2.0E-25
sp|Q9ZH99|IDH_COXBU Isocitrate dehydrogenase [NADP] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=icd PE=1 SV=1 9 333 4.0E-25
sp|P99167|IDH_STAAN Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain N315) GN=icd PE=1 SV=1 9 336 8.0E-25
sp|P65099|IDH_STAAM Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=icd PE=3 SV=1 9 336 8.0E-25
sp|Q5HF79|IDH_STAAC Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain COL) GN=icd PE=3 SV=1 9 336 8.0E-25
sp|Q4QQT5|IDHG2_RAT Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Rattus norvegicus PE=2 SV=1 7 364 9.0E-25
sp|Q8CNX4|IDH_STAES Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=icd PE=3 SV=1 9 336 1.0E-24
sp|Q5HNL1|IDH_STAEQ Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=icd PE=3 SV=1 9 336 1.0E-24
sp|Q5RBT4|IDH3B_PONAB Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Pongo abelii GN=IDH3B PE=2 SV=1 7 319 3.0E-24
sp|P41560|IDH1_COLMA Isocitrate dehydrogenase [NADP] 1 OS=Colwellia maris GN=icdI PE=1 SV=2 9 324 5.0E-24
sp|Q02NB5|IDH_PSEAB Isocitrate dehydrogenase [NADP] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=icd PE=1 SV=1 9 329 8.0E-24
sp|Q8BPC6|IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus PE=2 SV=1 7 361 9.0E-24
sp|P96318|IDH_CALNO Isocitrate dehydrogenase [NADP] OS=Caldococcus noboribetus GN=icd PE=1 SV=2 9 316 7.0E-15
sp|Q9AQC8|LEU3_BUCUL 3-isopropylmalate dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuB PE=3 SV=1 239 357 2.0E-14
sp|P50214|IDH_NOSS1 Isocitrate dehydrogenase [NADP] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=icd PE=3 SV=1 226 336 3.0E-09
sp|P80046|IDH_SYNY3 Isocitrate dehydrogenase [NADP] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=icd PE=1 SV=2 226 332 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|052730
MERTRLYTIAVLPGDGIGLEVMPPALRCLEAAGKRFGFQLSFRHYDWASCRYYSQHGVMIPSNWKDLLQACDAIY
FGAVGDPASVPDHISLWGSLLLFRREFDQFINLRPCRLIPGVTSPLANREGRKIDFVTVRENTEGEYSSIGGRIF
HDTERETVIQNTVFTRVGVDRVIRYAFEVARSRPAKRLTSATKSNGISITMPYWDERFEAIAKEYPDINVDKYHI
DILCAHFVLRPHIFDVVVGSNLFGDILSDLGPACTGTIGIAPSANLNPLSKRDDPNWCPSLFEPVHGSAPDIAGK
GIANPVGMIWAGQMMLEHLGETDAAQVMMAAIEKVLKEGRESQLRGEGDLLTPDMLGSGTTEGLGAAIEKAIATI
KI*
Coding >AgabiH97|052730
ATGGAGCGCACCCGTTTGTACACAATAGCCGTCTTACCTGGGGATGGAATTGGCCTCGAGGTGATGCCTCCTGCT
CTCCGGTGTCTCGAGGCGGCAGGGAAGCGATTTGGCTTTCAGTTAAGCTTCCGGCATTACGACTGGGCGTCGTGT
AGATACTACAGCCAGCATGGTGTTATGATACCTAGCAATTGGAAAGATCTCTTGCAGGCATGCGACGCAATCTAC
TTTGGCGCAGTTGGCGATCCTGCCTCAGTCCCTGATCATATATCATTATGGGGCAGCCTTCTTCTGTTCCGGCGA
GAGTTTGATCAGTTCATCAACCTGCGCCCGTGCCGCCTTATCCCCGGCGTCACTTCACCTCTCGCGAATAGAGAA
GGCAGAAAGATCGATTTCGTTACGGTGCGAGAGAACACCGAGGGCGAATACAGTTCTATAGGTGGCCGAATCTTT
CATGACACAGAGCGGGAGACAGTGATCCAAAATACTGTCTTCACCCGTGTTGGAGTGGATAGAGTGATTCGCTAT
GCCTTCGAGGTCGCCAGGAGTCGGCCAGCCAAGCGACTTACATCCGCTACCAAATCCAATGGTATATCGATCACG
ATGCCTTACTGGGATGAACGATTCGAAGCCATCGCCAAAGAATACCCCGACATTAACGTCGACAAATACCACATC
GACATCCTTTGCGCTCATTTCGTCCTCAGGCCGCACATTTTTGACGTAGTCGTAGGTTCAAACCTGTTTGGAGAT
ATTCTCTCCGATCTTGGACCTGCCTGCACTGGTACCATTGGCATCGCGCCTTCCGCCAATCTCAACCCTCTGTCC
AAACGCGATGATCCTAACTGGTGTCCCAGTCTTTTCGAGCCTGTCCACGGTAGCGCCCCGGACATTGCTGGAAAG
GGGATTGCGAATCCCGTGGGCATGATTTGGGCTGGACAAATGATGTTGGAGCATCTCGGAGAAACCGATGCCGCA
CAGGTAATGATGGCTGCGATTGAGAAAGTACTGAAGGAGGGAAGGGAATCACAACTGCGGGGAGAAGGCGATCTG
CTAACACCCGATATGTTGGGAAGCGGGACGACAGAAGGCTTGGGTGCCGCCATTGAGAAGGCAATTGCAACGATT
AAAATATGA
Transcript >AgabiH97|052730
ATGGAGCGCACCCGTTTGTACACAATAGCCGTCTTACCTGGGGATGGAATTGGCCTCGAGGTGATGCCTCCTGCT
CTCCGGTGTCTCGAGGCGGCAGGGAAGCGATTTGGCTTTCAGTTAAGCTTCCGGCATTACGACTGGGCGTCGTGT
AGATACTACAGCCAGCATGGTGTTATGATACCTAGCAATTGGAAAGATCTCTTGCAGGCATGCGACGCAATCTAC
TTTGGCGCAGTTGGCGATCCTGCCTCAGTCCCTGATCATATATCATTATGGGGCAGCCTTCTTCTGTTCCGGCGA
GAGTTTGATCAGTTCATCAACCTGCGCCCGTGCCGCCTTATCCCCGGCGTCACTTCACCTCTCGCGAATAGAGAA
GGCAGAAAGATCGATTTCGTTACGGTGCGAGAGAACACCGAGGGCGAATACAGTTCTATAGGTGGCCGAATCTTT
CATGACACAGAGCGGGAGACAGTGATCCAAAATACTGTCTTCACCCGTGTTGGAGTGGATAGAGTGATTCGCTAT
GCCTTCGAGGTCGCCAGGAGTCGGCCAGCCAAGCGACTTACATCCGCTACCAAATCCAATGGTATATCGATCACG
ATGCCTTACTGGGATGAACGATTCGAAGCCATCGCCAAAGAATACCCCGACATTAACGTCGACAAATACCACATC
GACATCCTTTGCGCTCATTTCGTCCTCAGGCCGCACATTTTTGACGTAGTCGTAGGTTCAAACCTGTTTGGAGAT
ATTCTCTCCGATCTTGGACCTGCCTGCACTGGTACCATTGGCATCGCGCCTTCCGCCAATCTCAACCCTCTGTCC
AAACGCGATGATCCTAACTGGTGTCCCAGTCTTTTCGAGCCTGTCCACGGTAGCGCCCCGGACATTGCTGGAAAG
GGGATTGCGAATCCCGTGGGCATGATTTGGGCTGGACAAATGATGTTGGAGCATCTCGGAGAAACCGATGCCGCA
CAGGTAATGATGGCTGCGATTGAGAAAGTACTGAAGGAGGGAAGGGAATCACAACTGCGGGGAGAAGGCGATCTG
CTAACACCCGATATGTTGGGAAGCGGGACGACAGAAGGCTTGGGTGCCGCCATTGAGAAGGCAATTGCAACGATT
AAAATATGA
Gene >AgabiH97|052730
ATGGAGCGCACCCGTTTGTACACAATAGCCGTCTTACCTGGGGATGGAATTGGCCTCGAGGTGATGCCTCCTGCT
CTCCGGTGTCTCGAGGCGGCAGGGAAGCGATTTGGCTTTCAGTTAAGCTTCCGGCATTACGACTGGGCGTCGTGT
AGATACTACAGCCAGCATGGTGTTATGATACCTAGCAATTGGAAAGATCTCTTGCAGGCATGCGACGCAATCTAC
TTTGGCGCAGGTAAGCCTTGCTACGTGGTATTGTCGGCTTGGGTCGCTTATGCATCCCCACTTGTAGTTGGCGAT
CCTGCCTCAGTCCCTGATCATATATCATTATGGGGCAGCCTTCTTCTGTTCCGGCGAGAGTTTGATCAGTTCATC
AACCTGCGCCCGTGCCGCCTTATCCCCGGCGTCACTTCACCTCTCGCGAATAGAGAAGGCAGAAAGATCGATTTC
GTTACGGTGCGAGAGAACACCGAGGGCGAATACAGTTCTATAGGTGGCCGAATCTTTCATGACACAGAGCGGGAG
ACAGTGATCCAAAATACTGTCTTCACCCGTGTTGGAGTGGATAGAGTGATTCGCTATGCCTTCGAGGTCGCCAGG
AGTCGGCCAGCCAAGCGACTTACATCCGCTACCAAATCCAATGGTATATCGATCACGATGCCTTACTGGGATGAA
CGATTCGAAGCCATCGCCAAAGAATACCCCGACATTAACGTCGACAAATACCACATCGACATCCTTTGCGCTCAT
TTCGTCCTCAGGCCGCACATTTTTGACGTAGTCGTAGGTTCAAACCTGTTTGGAGATATTCTCTCCGATCTTGGA
CCTGCCTGCACTGGTACCATTGGCATCGCGCCTTCCGCCAATCTCAACCCTCTGTCCAAACGCGATGATCCTAAC
TGGTGTCCCAGTCTTTTCGAGCCTGTCCACGGTAGCGCCCCGGACATTGCTGGAAAGGGGATTGCGAATCCCGTG
GGCATGATTTGGGCTGGACAAATGATGTTGGAGCATCTCGGAGAAACCGATGCCGCACAGGTAATGATGGCTGCG
ATTGAGAAAGTACTGAAGGAGGGAAGGGAATCACAACTGCGGGGAGAAGGCGATCTGCTAACACCCGATATGTTG
GGAAGCGGGACGACAGAAGGCTTGGGTGCCGCCATTGAGAAGGCAATTGCAACGATTAAAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail