Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|052710
Gene name
Locationscaffold_3:23977..26775
Strand-
Gene length (bp)2798
Transcript length (bp)2016
Coding sequence length (bp)2016
Protein length (aa) 672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10300 Iml2-TPR_39 Iml2/Tetratricopeptide repeat protein 39 5.2E-79 19 561

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8NVW1|IML2_COPC7 Mitochondrial outer membrane protein IML2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=IML2 PE=3 SV=2 10 669 0.0E+00
sp|B0XQF6|IML2_ASPFC Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=iml2 PE=3 SV=1 6 597 3.0E-43
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 6 597 1.0E-42
sp|A2QQE8|IML2_ASPNC Mitochondrial outer membrane protein iml2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=iml2 PE=3 SV=1 6 597 1.0E-40
sp|A1D345|IML2_NEOFI Mitochondrial outer membrane protein iml2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml2 PE=3 SV=1 20 597 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8NVW1|IML2_COPC7 Mitochondrial outer membrane protein IML2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=IML2 PE=3 SV=2 10 669 0.0E+00
sp|B0XQF6|IML2_ASPFC Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=iml2 PE=3 SV=1 6 597 3.0E-43
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 6 597 1.0E-42
sp|A2QQE8|IML2_ASPNC Mitochondrial outer membrane protein iml2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=iml2 PE=3 SV=1 6 597 1.0E-40
sp|A1D345|IML2_NEOFI Mitochondrial outer membrane protein iml2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml2 PE=3 SV=1 20 597 6.0E-40
sp|Q0D1F8|IML2_ASPTN Mitochondrial outer membrane protein iml2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml2 PE=3 SV=1 7 655 6.0E-39
sp|A1CQ80|IML2_ASPCL Mitochondrial outer membrane protein iml2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml2 PE=3 SV=1 20 597 1.0E-38
sp|Q7SA06|IML2_NEUCR Mitochondrial outer membrane protein iml-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml-2 PE=3 SV=1 5 523 1.0E-36
sp|A3GGT0|IML2_PICST Mitochondrial outer membrane protein IML2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IML2 PE=3 SV=2 4 661 5.0E-36
sp|A7TST2|IML2_VANPO Mitochondrial outer membrane protein IML2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=IML2 PE=3 SV=1 13 513 5.0E-36
sp|Q6BZZ6|IML2_YARLI Mitochondrial outer membrane protein IML2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IML2 PE=3 SV=1 9 501 2.0E-35
sp|Q6FJV9|IML2_CANGA Mitochondrial outer membrane protein IML2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IML2 PE=3 SV=1 13 564 1.0E-32
sp|A6ZZY2|YKR18_YEAS7 Mitochondrial outer membrane protein SCY_3392 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_3392 PE=3 SV=1 13 510 2.0E-32
sp|P36114|YKR18_YEAST Mitochondrial outer membrane protein YKR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR018C PE=1 SV=1 13 510 5.0E-32
sp|Q2H2B2|IML2_CHAGB Mitochondrial outer membrane protein IML2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML2 PE=3 SV=1 4 499 8.0E-31
sp|A4QTI0|IML2_MAGO7 Mitochondrial outer membrane protein IML2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=IML2 PE=3 SV=1 5 420 4.0E-30
sp|P47031|IML2_YEAST Mitochondrial outer membrane protein IML2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IML2 PE=1 SV=1 34 501 1.0E-28
sp|A6ZPP2|IML2_YEAS7 Mitochondrial outer membrane protein IML2 OS=Saccharomyces cerevisiae (strain YJM789) GN=IML2 PE=3 SV=1 34 501 1.0E-28
sp|A7E727|IML2_SCLS1 Mitochondrial outer membrane protein iml2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=iml2 PE=3 SV=1 1 498 8.0E-27
sp|O94699|YG1G_SCHPO Mitochondrial outer membrane protein C83.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.16c PE=3 SV=1 234 501 5.0E-25
sp|Q6FTE0|YKR18_CANGA Mitochondrial outer membrane protein CAGL0G03245g OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G03245g PE=3 SV=1 13 560 2.0E-24
sp|O13693|YDYE_SCHPO Uncharacterized protein C11E3.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.14 PE=2 SV=1 233 652 7.0E-23
sp|Q59ZW2|IML2_CANAL Mitochondrial outer membrane protein IML2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IML2 PE=3 SV=1 233 576 1.0E-22
sp|Q6CSC1|IML2_KLULA Mitochondrial outer membrane protein IML2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IML2 PE=3 SV=1 45 500 7.0E-22
sp|Q0VGK2|TT39C_RAT Tetratricopeptide repeat protein 39C OS=Rattus norvegicus GN=Ttc39c PE=2 SV=1 217 620 2.0E-21
sp|Q6BXP8|IML2_DEBHA Mitochondrial outer membrane protein IML2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IML2 PE=3 SV=2 233 500 2.0E-20
sp|Q5SRH9|TT39A_HUMAN Tetratricopeptide repeat protein 39A OS=Homo sapiens GN=TTC39A PE=2 SV=1 239 499 3.0E-20
sp|Q8VE09|TT39C_MOUSE Tetratricopeptide repeat protein 39C OS=Mus musculus GN=Ttc39c PE=1 SV=2 240 607 1.0E-19
sp|Q1LXE6|TT39C_DANRE Tetratricopeptide repeat protein 39C OS=Danio rerio GN=ttc39c PE=2 SV=1 231 444 2.0E-19
sp|A2ACP1|TT39A_MOUSE Tetratricopeptide repeat protein 39A OS=Mus musculus GN=Ttc39a PE=2 SV=1 239 499 4.0E-19
sp|A5E1Y3|IML2_LODEL Mitochondrial outer membrane protein IML2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IML2 PE=3 SV=1 173 421 5.0E-19
sp|Q8N584|TT39C_HUMAN Tetratricopeptide repeat protein 39C OS=Homo sapiens GN=TTC39C PE=2 SV=2 240 607 3.0E-18
sp|A5DH00|IML2_PICGU Mitochondrial outer membrane protein IML2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=IML2 PE=3 SV=2 233 586 5.0E-18
sp|A1A5Y5|TT39A_DANRE Tetratricopeptide repeat protein 39A OS=Danio rerio GN=ttc39a PE=2 SV=1 240 500 7.0E-18
sp|Q8BYY4|TT39B_MOUSE Tetratricopeptide repeat protein 39B OS=Mus musculus GN=Ttc39b PE=1 SV=1 240 499 4.0E-17
sp|D3ZC96|TT39B_RAT Tetratricopeptide repeat protein 39B OS=Rattus norvegicus GN=Ttc39b PE=3 SV=1 217 499 8.0E-17
sp|Q28DB0|TT39B_XENTR Tetratricopeptide repeat protein 39B OS=Xenopus tropicalis GN=ttc39b PE=2 SV=1 240 499 8.0E-17
sp|Q5XHH9|TT39B_XENLA Tetratricopeptide repeat protein 39B OS=Xenopus laevis GN=ttc39b PE=2 SV=1 240 496 5.0E-16
sp|Q95LT8|TT39B_MACFA Tetratricopeptide repeat protein 39B OS=Macaca fascicularis GN=TTC39B PE=2 SV=1 240 500 6.0E-16
sp|Q5VTQ0|TT39B_HUMAN Tetratricopeptide repeat protein 39B OS=Homo sapiens GN=TTC39B PE=1 SV=4 240 500 8.0E-16
sp|Q28D40|TT39A_XENTR Tetratricopeptide repeat protein 39A OS=Xenopus tropicalis GN=ttc39a PE=2 SV=1 240 499 6.0E-14
sp|Q09266|YQD6_CAEEL Uncharacterized protein C32D5.6 OS=Caenorhabditis elegans GN=C32D5.6 PE=4 SV=1 230 459 3.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|052710
MDLDRELATLSDASNAFGRLFEDDMDGGRALFDGKDDPFHLIGLGTAAFLEAALGLEAHVIEEANRALGLAEAGT
RKFTKQTQVAGNHRFQPGIEWEIINAHAVILLGLVHALSESYVGYLQCLYALNSAHSKFTKLFKSVFPNGLDPYL
SPSSAISDAASHGSTTTSLTGSSSSSVSNSSFSSPASSVTTLPRSTSSEPKKRGFLIGRFTSTSSPALTEVHPPD
PSKPDNPIDDLIIAGTAFGYGLFNLAFSLLPKRVQSVVGLFGFKADRKLGLNALTVSAARNDTHSVFAGLVLMTY
YGVVLLLSGFHANESDTLKEYQSLVDRVYDRYPNGALWILNKAKLLRMSNDPEAAINVLEKGLKPERQIRYDQGD
SLLVFELAWTLLGQRRYEEAAKSFLRITELNTWSHATYYFVAAGCYWSLGNYEESQRLFDAIPGLLEKKIGGKDL
PTEVFIKKKIAFYQSKQKRLGKKEANFVEAITFNPAEELGAFWNNYARISDTIAHLHINEWYSTLPPHKISSPHS
SPSENPSPSKSKDLAVLDTPDEFALRSLLLGIIHRTIKDYSTSRAYLLDAHSYQNQITNSTWIGSVSMFELAVLD
LKEVEAVEMQGNEMGQALRDKWQSAIKSAGQHVDKAMALVTNSTDLSSRLDMRVSILRDEIGSKKAALGIV*
Coding >AgabiH97|052710
ATGGATCTCGACCGCGAACTTGCTACTCTCAGCGACGCCAGCAATGCCTTCGGCCGTCTTTTCGAAGATGACATG
GATGGCGGCAGAGCCCTTTTCGATGGCAAGGATGATCCATTTCACCTTATCGGCCTCGGTACTGCTGCCTTCCTC
GAGGCTGCGTTGGGGCTCGAGGCACACGTCATCGAGGAGGCGAATCGTGCTCTTGGTCTTGCAGAGGCCGGCACC
CGCAAATTTACGAAACAAACACAAGTTGCGGGGAACCATCGCTTCCAACCTGGTATAGAATGGGAGATCATCAAC
GCCCACGCCGTTATTCTACTCGGACTTGTTCATGCTCTAAGTGAATCCTACGTGGGTTATCTACAATGCCTTTAT
GCCCTCAATTCTGCTCATTCCAAGTTTACAAAACTCTTCAAATCCGTTTTTCCCAACGGACTCGATCCTTATCTC
TCTCCGTCATCTGCAATTTCAGACGCAGCCAGTCACGGGTCAACTACGACTAGTTTGACAGGTTCAAGCTCAAGC
TCCGTCTCGAATTCATCTTTCTCATCTCCCGCGTCTTCCGTCACAACTCTTCCCCGCTCTACCAGCTCGGAGCCG
AAGAAACGTGGTTTCCTAATTGGCCGCTTTACGTCGACATCTTCTCCAGCTTTGACCGAGGTCCATCCCCCCGAT
CCGTCCAAGCCGGACAATCCGATCGATGATCTAATCATTGCAGGAACTGCATTTGGCTATGGGCTTTTCAATCTT
GCTTTTTCCCTCCTTCCGAAACGAGTACAGAGCGTCGTTGGACTTTTTGGATTCAAGGCAGACAGGAAACTGGGT
CTCAATGCCCTCACAGTTTCAGCTGCTCGGAATGATACTCATTCCGTATTCGCTGGACTCGTGCTTATGACTTAC
TATGGCGTCGTCCTTTTGCTCTCTGGATTCCACGCAAATGAATCTGACACTCTCAAAGAGTACCAATCCCTAGTT
GATAGAGTGTACGACAGATATCCTAATGGTGCCCTATGGATTCTCAATAAGGCTAAACTCTTGCGTATGTCTAAT
GACCCCGAGGCCGCTATCAATGTCCTTGAGAAGGGACTGAAGCCAGAGCGCCAAATTCGTTACGATCAAGGTGAC
AGTCTTCTCGTATTTGAGCTCGCTTGGACCCTTTTGGGGCAGCGCAGGTACGAAGAAGCTGCAAAATCATTCCTT
CGAATCACCGAACTCAACACCTGGAGCCACGCCACCTATTATTTTGTAGCAGCCGGCTGCTACTGGTCGCTTGGC
AACTACGAAGAATCTCAAAGACTTTTTGATGCTATCCCAGGACTTCTTGAGAAGAAGATTGGCGGAAAAGATCTC
CCCACCGAAGTTTTTATTAAAAAGAAGATCGCCTTTTACCAAAGTAAGCAAAAACGGCTCGGGAAGAAAGAAGCC
AATTTCGTAGAGGCTATTACCTTCAATCCTGCCGAGGAATTGGGCGCTTTCTGGAACAACTATGCGCGAATCTCA
GACACTATAGCTCATCTTCATATCAACGAATGGTATTCAACATTACCACCTCACAAAATTTCGAGTCCTCACTCT
TCTCCATCCGAGAATCCATCTCCATCTAAATCCAAGGATCTTGCGGTGCTAGATACACCGGATGAATTTGCGCTT
CGATCGCTACTCCTCGGCATCATCCACCGTACAATCAAAGATTATTCTACAAGTCGTGCTTACCTCCTCGATGCC
CACAGCTATCAAAATCAAATAACCAACAGTACTTGGATTGGTAGCGTTTCTATGTTCGAACTTGCAGTTCTAGAT
TTGAAAGAAGTTGAAGCTGTTGAAATGCAAGGAAATGAAATGGGACAGGCGTTGAGAGATAAGTGGCAGTCGGCC
ATCAAATCCGCTGGACAGCATGTGGATAAGGCTATGGCACTTGTGACGAATTCGACGGATTTGTCTTCGAGGCTT
GACATGAGAGTCTCGATCTTGAGAGATGAGATCGGGTCAAAGAAGGCTGCGTTGGGAATTGTATAA
Transcript >AgabiH97|052710
ATGGATCTCGACCGCGAACTTGCTACTCTCAGCGACGCCAGCAATGCCTTCGGCCGTCTTTTCGAAGATGACATG
GATGGCGGCAGAGCCCTTTTCGATGGCAAGGATGATCCATTTCACCTTATCGGCCTCGGTACTGCTGCCTTCCTC
GAGGCTGCGTTGGGGCTCGAGGCACACGTCATCGAGGAGGCGAATCGTGCTCTTGGTCTTGCAGAGGCCGGCACC
CGCAAATTTACGAAACAAACACAAGTTGCGGGGAACCATCGCTTCCAACCTGGTATAGAATGGGAGATCATCAAC
GCCCACGCCGTTATTCTACTCGGACTTGTTCATGCTCTAAGTGAATCCTACGTGGGTTATCTACAATGCCTTTAT
GCCCTCAATTCTGCTCATTCCAAGTTTACAAAACTCTTCAAATCCGTTTTTCCCAACGGACTCGATCCTTATCTC
TCTCCGTCATCTGCAATTTCAGACGCAGCCAGTCACGGGTCAACTACGACTAGTTTGACAGGTTCAAGCTCAAGC
TCCGTCTCGAATTCATCTTTCTCATCTCCCGCGTCTTCCGTCACAACTCTTCCCCGCTCTACCAGCTCGGAGCCG
AAGAAACGTGGTTTCCTAATTGGCCGCTTTACGTCGACATCTTCTCCAGCTTTGACCGAGGTCCATCCCCCCGAT
CCGTCCAAGCCGGACAATCCGATCGATGATCTAATCATTGCAGGAACTGCATTTGGCTATGGGCTTTTCAATCTT
GCTTTTTCCCTCCTTCCGAAACGAGTACAGAGCGTCGTTGGACTTTTTGGATTCAAGGCAGACAGGAAACTGGGT
CTCAATGCCCTCACAGTTTCAGCTGCTCGGAATGATACTCATTCCGTATTCGCTGGACTCGTGCTTATGACTTAC
TATGGCGTCGTCCTTTTGCTCTCTGGATTCCACGCAAATGAATCTGACACTCTCAAAGAGTACCAATCCCTAGTT
GATAGAGTGTACGACAGATATCCTAATGGTGCCCTATGGATTCTCAATAAGGCTAAACTCTTGCGTATGTCTAAT
GACCCCGAGGCCGCTATCAATGTCCTTGAGAAGGGACTGAAGCCAGAGCGCCAAATTCGTTACGATCAAGGTGAC
AGTCTTCTCGTATTTGAGCTCGCTTGGACCCTTTTGGGGCAGCGCAGGTACGAAGAAGCTGCAAAATCATTCCTT
CGAATCACCGAACTCAACACCTGGAGCCACGCCACCTATTATTTTGTAGCAGCCGGCTGCTACTGGTCGCTTGGC
AACTACGAAGAATCTCAAAGACTTTTTGATGCTATCCCAGGACTTCTTGAGAAGAAGATTGGCGGAAAAGATCTC
CCCACCGAAGTTTTTATTAAAAAGAAGATCGCCTTTTACCAAAGTAAGCAAAAACGGCTCGGGAAGAAAGAAGCC
AATTTCGTAGAGGCTATTACCTTCAATCCTGCCGAGGAATTGGGCGCTTTCTGGAACAACTATGCGCGAATCTCA
GACACTATAGCTCATCTTCATATCAACGAATGGTATTCAACATTACCACCTCACAAAATTTCGAGTCCTCACTCT
TCTCCATCCGAGAATCCATCTCCATCTAAATCCAAGGATCTTGCGGTGCTAGATACACCGGATGAATTTGCGCTT
CGATCGCTACTCCTCGGCATCATCCACCGTACAATCAAAGATTATTCTACAAGTCGTGCTTACCTCCTCGATGCC
CACAGCTATCAAAATCAAATAACCAACAGTACTTGGATTGGTAGCGTTTCTATGTTCGAACTTGCAGTTCTAGAT
TTGAAAGAAGTTGAAGCTGTTGAAATGCAAGGAAATGAAATGGGACAGGCGTTGAGAGATAAGTGGCAGTCGGCC
ATCAAATCCGCTGGACAGCATGTGGATAAGGCTATGGCACTTGTGACGAATTCGACGGATTTGTCTTCGAGGCTT
GACATGAGAGTCTCGATCTTGAGAGATGAGATCGGGTCAAAGAAGGCTGCGTTGGGAATTGTATAA
Gene >AgabiH97|052710
ATGGATCTCGACCGCGAACTTGCTACTCTCAGCGACGCCAGCAATGCCTTCGGCCGTCTTTTCGAAGATGACATG
GATGGCGGCAGAGCCCTTTTCGATGGCAAGGATGATCCATTTCACCTTATCGGCCTCGGTACTGCTGCCTTCCTC
GAGGCTGCGTTGGGGCTCGAGGTCAGGAGAGTCTTTCTCAGTTCAATGCAGGAGCTAAAATTGTTATAGGCACAC
GTCATCGAGGAGGCGAATCGTGCTCTTGGTCTTGCAGAGGCCGGCACCCGCAAATTTACGAAACAAACACAAGTT
GCGGGGAACCATCGCTTCCAACCTGGTATAGAATGGGAGATCATCAACGCCCACGCCGTTATTCTACTCGGACTT
GTTCATGCTCTAAGGTATGTGTCTTGTCAAGTTCACTGCCTTGGTCACCGCTTCACGCGCTCCTCAGTGAATCCT
ACGTGGGTTATCTACAATGCCTGTATGTCTTCGTCTCCATATCCCTCCTATATACTCTAACGATCATATTGTAGT
TATGCCCTCAATTCGTGTGTCTCGTTGTACTGCTTAGATTCATTGTACTGAACTTAGCTCAGTGCTCATTCCAAG
TTTACAAAGTAGCTGATGTCTTTTTCATCCATTGTAGCCTACTCACCATTTTTTGAAGACTCTTCAAATCCGTTT
TTCCCAACGGACTCGATCCTTATCTCTCTCCGTCATCTGCAATTTCAGACGCAGCCAGTCACGGGTCAACTACGA
CTAGTTTGACAGGTTCAAGCTCAAGCTCCGTCTCGAATTCATCTTTCTCATCTCCCGCGTCTTCCGTCACAACTC
TTCCCCGCTCTACCAGCTCGGAGCCGAAGAAACGTGGTTTCCTAATTGGCCGCTTTACGTCGACATCTTCTCCAG
CTTTGACCGAGGTCCATCCCCCCGATCCGTCCAAGCCGGACAATCCGATCGATGATCTAATCATTGCAGGAACTG
CATTTGGTCAGTACTGAATTGGTATCAATTTTGTTTATTCTTGACACTTCACTGCGGTCTAGGCTATGGGCTTTT
CAATCTTGCTTTTTCCCTCCTTCCGAAACGAGTACAGTGAGTGTGGAAAGTATAGTAGCCTCTCATATCTCATTT
TCCGTAGGAGCGTCGTTGGACTTTTTGGATTCAAGGCAGACAGGAAACTGGGTCTCAATGCCCTCACAGTTTCAG
CTGCTCGGAATGATACTCATTCCGTATTCGCTGGGTGACATCCTCCCTTTTCCATTCGTTTGATGCGTTTCTTAC
ACCTACTCATGATGATAGACTCGTGCTTATGACTTACTATGGCGTCGTCCTTTTGCTCTCTGGATTCCACGCAAA
TGAATCTGACACTCTCAAAGAGTACCAATCCCTAGTTGATAGGTCAGTAAATATGATTTTGACAAATTATTCGCT
CACCTATGGTGTTTAGAGTGTACGACAGATATCCTAATGGTGCCCTATGGATTCTCAATAAGGTTGTTACTTCCC
ACCACCGTTTTATAATTTTTGCTTACGGTCGTAACCCTCAAGGCTAAACTCTTGCGTATGTCTAATGACCCCGAG
GCCGCTATCAATGTCCTTGAGAAGGGACTGAAGCCAGAGCGCCAAATTCGTTACGATCAAGGTGACAGTCTTGTA
CGTTTCCGACTCTCCCCAGGTGGCCTTGACTGACCACTCACTATTGCAAAAAGCTCGTATTTGAGCTCGCTTGGA
CCCTTTTGGGGCAGCGCAGGTACGAAGAAGCTGCAAAATCATTCCTTCGAATCACCGAACTCAACACCTGGTATC
ATCTTTAATATATTCTCCATGCAGCACCTTATATGTGTCCACAGGAGCCACGCCACCTATTATTTTGTAGCAGCC
GGCTGCTACTGGTCGCTTGGCAACTACGAAGAATCTCAAAGACTTTTTGATGCTATCCCAGGACTTCTTGAGAAG
AAGATTGGCGGAAAAGATCTCCCCACCGAAGTTTTTATTAAAAAGAAGAGTATGAAAACCCGCCACTTGTCCATA
AAATTCTTTCTAAAAAATAGTTACAGTCGCCTTTTACCAAAGTAAGCAAAAACGGCTCGGGAAGAAAGAAGCCAA
TTTCGTAGAGGCTATTACCTTCAATCCTGCCGAGGGTATGTCATTTGTCGACCCCGTATAAATATCATCTCACCA
CTTCACTATATATCCAGAATTGGGCGCTTGTACGTGCCAATAATTCGTCTCTTATAATATTGTTTTCTGACCTGC
TTTTAGTCTGGAACAACTATGCGCGAATCTCAGACACTATAGCTCATCTTCATATCAACGAATGGTATTCAACAT
TACCACCTCACAAAATTTCGAGTCCTCACTCTTCTCCATCCGAGAATCCATCTCCATCTAAATCCAAGGATCTTG
CGGTGCTAGATACACCGGATGAATTTGCGCTTCGATCGCTACTCCTCGGCATCATCCACCGTACAATCAAAGATT
ATTCTACAAGTCGTGCTTACCTCCTCGATGCCCACAGCTATCAAAATCAAATAACCAACAGTACTTGGATTGGTA
GCGTTTCTATGTTCGAACTTGCAGTTCTAGATTTGAAAGAAGTTGAAGCTGTTGAAATGCAAGGAAATGAAATGG
GACAGGCGTTGAGAGATAAGTGGCAGTCGGCCATCAAATCCGCTGGACAGCATGTGGATAAGGCTATGGCACTTG
TGACGAATTCGACGGATTTGTCTTCGAGGCTTGACATGAGAGTCTCGATCTTGAGAGATGAGATCGGGTCAAAGA
AGGCTGCGTTGGGAATTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail