Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|052520
Gene name
Locationscaffold_2:3472643..3476005
Strand-
Gene length (bp)3362
Transcript length (bp)2844
Coding sequence length (bp)2844
Protein length (aa) 948

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18808 Importin_rep_4 Importin repeat 1.1E-17 341 432
PF02985 HEAT HEAT repeat 4.4E-05 475 503
PF12755 Vac14_Fab1_bd Vacuolar 14 Fab1-binding region 1.9E-04 449 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 1 921 1.0E-147
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 16 850 3.0E-106
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 16 850 1.0E-104
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 3 850 4.0E-99
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 346 850 3.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 1 921 1.0E-147
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 16 850 3.0E-106
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 16 850 1.0E-104
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 3 850 4.0E-99
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 346 850 3.0E-89
sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 346 850 7.0E-88
sp|Q54EW3|IPO5_DICDI Probable importin-5 homolog OS=Dictyostelium discoideum GN=DDB_G0291650 PE=3 SV=1 13 851 9.0E-42
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 334 704 2.0E-20
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap123 PE=3 SV=1 407 916 4.0E-18
sp|Q8VI75|IPO4_MOUSE Importin-4 OS=Mus musculus GN=Ipo4 PE=1 SV=1 408 695 1.0E-12
sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens GN=IPO4 PE=1 SV=2 408 694 2.0E-12
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 403 694 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|052520
MDSVVPAEITAELTQILSNLVQGDNDIRQNAEQAVNERLAQTPELYLLALAQFAILAELDVMRSFSLVLLRRLLF
RLAPAAAANPHQPRLTLYDHLSSNTLSTLQRLLLHSLSHERAPDVRKKAVDTITDLSKQEMARGRPWHALQLQAF
AIAQVQVAEHGVPPGALRESAFRIFAGCPNLVLDLHADGVLGVFQKGLQDTESVDVRHAALLAAVEYLSAADSQQ
LARSLSLMYPMLETVHLLSQSLSQPSTTTKTVYQHITQFLTTLTPLCTSHPTLFAPHLQLILSFLPQLILPAVDS
GPTPTAVVPFPSSASKQSAFEFPPPSAPTTHEPEIDDEAEARSTMRLTALEFMISLSEARPTMVRKNDNWVGVIV
RACLEGMGELDEDEDINVWLKEDPSVQSSAADDSPPSLYEQSLDRIACALGGRAVLPPAFQQIPSMLASYDWRAR
HAGLIAVASIAEGTGKVMMNELGKIVDLVTPMFRDTHPRVRHAACQCVGQLCTDLEAVMQERYHQQLFTVLIPTL
EDPEPRVHSHAAAALINFCEGVEHDTLIPYLDPIVERLLQLLNPGGDESLVKRYVQEQAITTLAMVADASEATFA
KHYPTIMPLLLNVLRNADKPEHQKLRIKAMECAGLVAIAVGRDIFRPDSATLVELLIRIQKSPVDPNDTQLGYYL
ISTWAKIGQALGEEFDPYLPLVMPNILKTASAKTDISVYEDDDDDSNTEREGWETVTVDGRTMGIKTSALEEKCQ
AFETLLIYCSTLGGKYAAYLSQTLEICIPCLKFDFHEGVREASAMLVPRLLDSGKISNTLTTQMVTATFNQLISC
IRSEPDSSFLASLYKCFTESLQVIGGPTNLPQEYHIGIIDATKHQLQALADKRRSRANRLAGDPDIDREDIALYE
QFEEFELQEMDKLLKDLDRNHPLRIAVSSVRELGVNEWDVEEGEETG*
Coding >AgabiH97|052520
ATGGACAGTGTTGTGCCGGCTGAAATTACGGCGGAACTGACGCAGATCTTGTCGAATCTCGTCCAGGGCGACAAC
GACATCCGCCAAAATGCTGAACAGGCCGTTAACGAGCGACTGGCGCAGACACCAGAGCTGTATTTGCTTGCGCTG
GCCCAGTTTGCGATTCTCGCCGAGCTCGACGTGATGCGCTCCTTTTCGCTCGTTCTTCTTCGTCGTTTATTGTTC
AGACTCGCACCTGCCGCCGCTGCCAACCCCCACCAGCCTCGATTGACGCTGTACGACCACCTCTCTTCCAACACT
CTCTCCACCCTCCAACGCCTCCTCCTCCACTCTCTCTCCCACGAGCGAGCACCCGACGTTCGCAAAAAGGCCGTC
GACACCATCACCGACCTCTCCAAACAGGAAATGGCCAGAGGTCGACCTTGGCACGCCCTCCAACTCCAGGCCTTT
GCTATTGCCCAAGTCCAAGTCGCAGAGCATGGCGTACCCCCGGGCGCCCTTCGAGAAAGTGCCTTTCGAATCTTT
GCAGGCTGTCCCAATCTCGTCCTCGATCTCCATGCCGACGGCGTCCTCGGCGTCTTTCAGAAAGGCCTCCAAGAT
ACCGAAAGTGTCGATGTTCGTCATGCAGCTCTCCTCGCCGCCGTCGAATATCTCTCCGCCGCCGACTCCCAACAA
CTCGCCCGCTCACTCTCTCTCATGTACCCCATGCTCGAAACCGTCCACCTACTCTCCCAATCCCTTTCACAACCC
TCCACAACCACCAAAACCGTCTATCAGCACATCACCCAATTCCTGACCACCCTCACGCCTCTCTGTACATCCCAT
CCCACCCTCTTTGCTCCCCATCTCCAACTCATCCTCTCCTTTCTCCCTCAACTCATCCTTCCCGCCGTCGACAGC
GGCCCAACTCCTACCGCAGTCGTACCCTTCCCCTCAAGTGCTTCCAAACAAAGCGCTTTTGAATTCCCTCCTCCC
TCTGCTCCTACCACCCACGAACCCGAAATCGACGATGAAGCAGAAGCCCGTTCAACCATGCGCCTTACAGCACTT
GAGTTCATGATCAGTCTATCCGAGGCCCGTCCAACTATGGTCCGCAAAAACGATAACTGGGTTGGCGTTATCGTC
CGTGCCTGTCTCGAAGGTATGGGAGAGTTGGACGAGGACGAGGACATCAACGTGTGGCTAAAAGAAGACCCGTCA
GTCCAATCCAGTGCTGCAGACGACTCTCCCCCGTCATTGTATGAACAATCCCTCGATCGCATTGCCTGTGCCCTC
GGTGGCCGTGCCGTCCTCCCACCTGCCTTTCAACAAATTCCCTCCATGCTCGCTAGCTACGACTGGCGAGCTCGA
CACGCTGGTCTTATCGCCGTCGCCTCTATTGCAGAGGGTACAGGCAAAGTCATGATGAATGAGCTCGGAAAAATC
GTCGACCTGGTTACTCCCATGTTCCGAGATACCCATCCTCGAGTTCGCCACGCCGCTTGTCAATGCGTAGGTCAA
CTATGCACCGACCTCGAGGCAGTCATGCAAGAACGATATCATCAACAACTCTTTACCGTACTCATCCCTACCCTC
GAAGATCCCGAACCACGCGTACATTCACACGCCGCTGCAGCTCTCATCAACTTTTGCGAAGGCGTCGAACACGAC
ACGCTCATCCCATACCTCGATCCTATAGTCGAACGCCTCTTGCAATTGCTCAATCCCGGAGGCGACGAATCCCTC
GTGAAGCGATATGTCCAAGAACAAGCTATCACGACCCTTGCTATGGTCGCCGACGCGAGTGAAGCCACCTTTGCG
AAACATTATCCGACCATCATGCCCCTTCTATTGAACGTCTTGAGGAATGCAGACAAGCCGGAACATCAAAAGCTG
CGGATAAAAGCTATGGAGTGTGCCGGGCTCGTTGCCATCGCTGTTGGCCGTGACATTTTCCGTCCCGACTCTGCC
ACGCTCGTAGAATTACTCATACGCATTCAAAAAAGCCCCGTTGATCCAAATGACACGCAACTCGGATATTATCTC
ATTTCAACGTGGGCGAAAATTGGTCAAGCACTCGGCGAAGAGTTTGATCCGTACCTGCCCCTCGTCATGCCCAAT
ATCCTCAAGACGGCGAGCGCCAAGACTGACATCTCCGTATACGAAGACGACGACGACGACTCTAATACCGAGCGC
GAGGGATGGGAGACCGTGACTGTTGATGGGCGAACGATGGGCATCAAAACGTCGGCCCTGGAAGAGAAATGCCAG
GCTTTCGAAACTTTACTCATCTACTGCTCGACACTCGGAGGCAAATACGCTGCATACCTGTCGCAGACCCTTGAA
ATCTGTATACCTTGTCTCAAATTCGATTTTCACGAGGGCGTGAGGGAGGCAAGTGCTATGCTGGTTCCTCGTCTC
CTCGATTCTGGCAAGATCTCCAACACACTCACGACGCAGATGGTCACAGCTACTTTTAATCAACTCATCTCGTGT
ATCCGATCCGAACCCGACTCTTCCTTCCTCGCCTCACTCTACAAGTGTTTCACCGAATCACTCCAAGTCATCGGC
GGACCCACAAATTTACCGCAAGAGTACCACATCGGCATCATCGATGCCACAAAACATCAACTTCAAGCTCTCGCC
GACAAACGGCGTTCGCGCGCCAACAGGCTGGCTGGGGACCCTGATATTGATAGAGAGGATATTGCGTTGTATGAA
CAGTTTGAAGAGTTTGAGTTGCAGGAGATGGATAAATTGTTGAAAGATTTGGATAGGAATCATCCGTTGAGGATT
GCGGTTTCGAGTGTGAGGGAGTTGGGGGTGAATGAGTGGGACGTCGAGGAGGGTGAGGAGACGGGGTGA
Transcript >AgabiH97|052520
ATGGACAGTGTTGTGCCGGCTGAAATTACGGCGGAACTGACGCAGATCTTGTCGAATCTCGTCCAGGGCGACAAC
GACATCCGCCAAAATGCTGAACAGGCCGTTAACGAGCGACTGGCGCAGACACCAGAGCTGTATTTGCTTGCGCTG
GCCCAGTTTGCGATTCTCGCCGAGCTCGACGTGATGCGCTCCTTTTCGCTCGTTCTTCTTCGTCGTTTATTGTTC
AGACTCGCACCTGCCGCCGCTGCCAACCCCCACCAGCCTCGATTGACGCTGTACGACCACCTCTCTTCCAACACT
CTCTCCACCCTCCAACGCCTCCTCCTCCACTCTCTCTCCCACGAGCGAGCACCCGACGTTCGCAAAAAGGCCGTC
GACACCATCACCGACCTCTCCAAACAGGAAATGGCCAGAGGTCGACCTTGGCACGCCCTCCAACTCCAGGCCTTT
GCTATTGCCCAAGTCCAAGTCGCAGAGCATGGCGTACCCCCGGGCGCCCTTCGAGAAAGTGCCTTTCGAATCTTT
GCAGGCTGTCCCAATCTCGTCCTCGATCTCCATGCCGACGGCGTCCTCGGCGTCTTTCAGAAAGGCCTCCAAGAT
ACCGAAAGTGTCGATGTTCGTCATGCAGCTCTCCTCGCCGCCGTCGAATATCTCTCCGCCGCCGACTCCCAACAA
CTCGCCCGCTCACTCTCTCTCATGTACCCCATGCTCGAAACCGTCCACCTACTCTCCCAATCCCTTTCACAACCC
TCCACAACCACCAAAACCGTCTATCAGCACATCACCCAATTCCTGACCACCCTCACGCCTCTCTGTACATCCCAT
CCCACCCTCTTTGCTCCCCATCTCCAACTCATCCTCTCCTTTCTCCCTCAACTCATCCTTCCCGCCGTCGACAGC
GGCCCAACTCCTACCGCAGTCGTACCCTTCCCCTCAAGTGCTTCCAAACAAAGCGCTTTTGAATTCCCTCCTCCC
TCTGCTCCTACCACCCACGAACCCGAAATCGACGATGAAGCAGAAGCCCGTTCAACCATGCGCCTTACAGCACTT
GAGTTCATGATCAGTCTATCCGAGGCCCGTCCAACTATGGTCCGCAAAAACGATAACTGGGTTGGCGTTATCGTC
CGTGCCTGTCTCGAAGGTATGGGAGAGTTGGACGAGGACGAGGACATCAACGTGTGGCTAAAAGAAGACCCGTCA
GTCCAATCCAGTGCTGCAGACGACTCTCCCCCGTCATTGTATGAACAATCCCTCGATCGCATTGCCTGTGCCCTC
GGTGGCCGTGCCGTCCTCCCACCTGCCTTTCAACAAATTCCCTCCATGCTCGCTAGCTACGACTGGCGAGCTCGA
CACGCTGGTCTTATCGCCGTCGCCTCTATTGCAGAGGGTACAGGCAAAGTCATGATGAATGAGCTCGGAAAAATC
GTCGACCTGGTTACTCCCATGTTCCGAGATACCCATCCTCGAGTTCGCCACGCCGCTTGTCAATGCGTAGGTCAA
CTATGCACCGACCTCGAGGCAGTCATGCAAGAACGATATCATCAACAACTCTTTACCGTACTCATCCCTACCCTC
GAAGATCCCGAACCACGCGTACATTCACACGCCGCTGCAGCTCTCATCAACTTTTGCGAAGGCGTCGAACACGAC
ACGCTCATCCCATACCTCGATCCTATAGTCGAACGCCTCTTGCAATTGCTCAATCCCGGAGGCGACGAATCCCTC
GTGAAGCGATATGTCCAAGAACAAGCTATCACGACCCTTGCTATGGTCGCCGACGCGAGTGAAGCCACCTTTGCG
AAACATTATCCGACCATCATGCCCCTTCTATTGAACGTCTTGAGGAATGCAGACAAGCCGGAACATCAAAAGCTG
CGGATAAAAGCTATGGAGTGTGCCGGGCTCGTTGCCATCGCTGTTGGCCGTGACATTTTCCGTCCCGACTCTGCC
ACGCTCGTAGAATTACTCATACGCATTCAAAAAAGCCCCGTTGATCCAAATGACACGCAACTCGGATATTATCTC
ATTTCAACGTGGGCGAAAATTGGTCAAGCACTCGGCGAAGAGTTTGATCCGTACCTGCCCCTCGTCATGCCCAAT
ATCCTCAAGACGGCGAGCGCCAAGACTGACATCTCCGTATACGAAGACGACGACGACGACTCTAATACCGAGCGC
GAGGGATGGGAGACCGTGACTGTTGATGGGCGAACGATGGGCATCAAAACGTCGGCCCTGGAAGAGAAATGCCAG
GCTTTCGAAACTTTACTCATCTACTGCTCGACACTCGGAGGCAAATACGCTGCATACCTGTCGCAGACCCTTGAA
ATCTGTATACCTTGTCTCAAATTCGATTTTCACGAGGGCGTGAGGGAGGCAAGTGCTATGCTGGTTCCTCGTCTC
CTCGATTCTGGCAAGATCTCCAACACACTCACGACGCAGATGGTCACAGCTACTTTTAATCAACTCATCTCGTGT
ATCCGATCCGAACCCGACTCTTCCTTCCTCGCCTCACTCTACAAGTGTTTCACCGAATCACTCCAAGTCATCGGC
GGACCCACAAATTTACCGCAAGAGTACCACATCGGCATCATCGATGCCACAAAACATCAACTTCAAGCTCTCGCC
GACAAACGGCGTTCGCGCGCCAACAGGCTGGCTGGGGACCCTGATATTGATAGAGAGGATATTGCGTTGTATGAA
CAGTTTGAAGAGTTTGAGTTGCAGGAGATGGATAAATTGTTGAAAGATTTGGATAGGAATCATCCGTTGAGGATT
GCGGTTTCGAGTGTGAGGGAGTTGGGGGTGAATGAGTGGGACGTCGAGGAGGGTGAGGAGACGGGGTGA
Gene >AgabiH97|052520
ATGGACAGTGTTGTGCCGGCTGAAATTACGGCGGAACTGACGCAGATCTTGTCGAATCTCGTCCAGGGCGACAAC
GACATCCGCCAAAAGTGAGTCAATATTGAAAGAGTGACCGTGTCTAACCCACTGCGTAGTGCTGAACAGGCCGTT
AACGAGCGACTGGCGCAGACACCAGAGCTGTATTTGCTTGCGCTGGCCCAGTTTGCGATTCTCGCCGAGCTCGAC
GTGATGCGCTCCTTTTCGCTCGTTCTTCTTCGTCGTTTATTGTTCAGACTCGCACCTGCCGCCGCTGCCAACCCC
CACCAGCCTCGATTGACGCTGTACGACCACCTCTCTTCCAACACTCTCTCCACCCTCCAACGCCTCCTCCTCCAC
TCTCTCTCCCACGAGCGAGCACCCGACGTTCGCAAAAAGGCCGTCGACACCATCACCGACCTCTCCAAACAGGAA
ATGGCCAGAGGTCGACCTTGGCACGCCCTCCAACTCCAGGCCTTTGCTATTGCCCAAGTCCAAGTCGCAGAGCAT
GGCGTACCCCCGGGCGCCCTTCGAGAAAGTGCCTTTCGAATCTTTGCAGGCTGTCCCAATCTCGTCCTCGATCTC
CATGCCGACGGCGTCCTCGGCGTCTTTCAGAAAGGCCTCCAAGATACCGAAAGTGTCGATGTACGTTCTTTTCCC
TACTGATATCTGCTCGTTTACATGATCGATACAGGTTCGTCATGCAGCTCTCCTCGCCGCCGTCGAATATCTCTC
CGCCGCCGACTCCCAACAACTCGCCCGCTCACTCTCTCTCATGTACCCCATGCTCGAAACCGTCCACCTACTCTC
CCAATCCCTTTCACAACCCTCCACAACCACCAAAACCGTCTATCAGCACATCACCCAATTCCTGACCACCCTCAC
GCCTCTCTGTACATCCCATCCCACCCTCTTTGCTCCCCATCTCCAACTCATCCTCTCCTTTCTCCCTCAACTCAT
CCTTCCCGCCGTCGACAGCGGCCCAACTCCTACCGCAGTCGTACCCTTCCCCTCAAGTGCTTCCAAACAAAGCGC
TTTTGAATTCCCTCCTCCCTCTGCTCCTACCACCCACGAACCCGAAATCGACGATGAAGCAGAAGCCCGTTCAAC
CATGCGCCTTACAGCACTTGAGTTCATGATCAGTCTATCCGAGGCCCGTCCAACTATGGTCCGCAAAAACGATAA
CTGGGTTGGCGTTATCGTCCGTGCCTGTCTCGAAGGTATGGGAGAGTTGGACGAGGACGAGGACATCAACGTGTG
GCTAAAAGAAGACGTGGGTCGTTCAGTTCTTTTTTATCCTCTCGCTCATTCTTTCCCAGCCGTCAGTCCAATCCA
GTGCTGCAGACGACTCTCCCCCGTCATTGTATGAACAATCCCTCGATCGCATTGCCTGTGCCCTCGGTGGCCGTG
CCGTCCTCCCACCTGCCTTTCAACAAATTCCCTCCATGCTCGCTAGCTACGACTGGCGAGCTCGACACGCTGGTC
TTATCGCCGTCGCCTCTATTGCAGAGGGTACAGGCAAAGTCATGATGAATGAGCTCGGAAAAATCGTCGAGTAAG
GTATTTTCTTCCTTCCTCACCAACTTTACTTACTGCTCGTAGCCTGGTTACTCCCATGTTCCGAGATACCCATCC
TCGAGTTCGCCACGCCGCTTGTCAATGCGTGTCAGTCCCTGTCCTCTTTCACTCACGTCTTGCTCACCCACCATA
GAGGTCAACTATGCACCGACCTCGAGGCAGGTCCAATTACTCAAATGGAAAGACCTCTCCTCACATGCATTTAGG
AAGTCATGCAAGAACGATATCATCAACAACTCTTTACCGTACTCATCCCTACCCTCGAAGATCCCGAACCACGGC
AAGTAACCTTCGTTTTTCATCGAGATACTCACTCACCCCCCCTCCAGCGTACATTCACACGCCGCTGCAGCTCTC
ATCAACTTTTGCGAAGGCGTCGAACACGACACGCTCATCCCATACCTCGATCCTATAGTCGAACGCCTCTTGCAA
TTGCTCAATCCCGGAGGCGACGAATCCCTCGTGAAGCGATATGTCCAAGAACAAGCTATCACGACCCTTGCTATG
GTCGCCGACGCGAGTGAAGCCACCTTTGCGAAACATTATCCGACCATCATGCCCCTTCTATTGAACGTCTTGAGG
AATGCAGACAAGCCGGAACATCAAAAGCTGCGGATAAAAGCTATGGAGTGTGCCGGGCTCGTTGGTATGTGTTCT
AGTCCTTCCCTCTAGCTGCTTCTCACCTACTTTAGCCATCGCTGTTGGCCGTGACATTTTCCGTCCCGACTCTGC
CACGCTCGTAGAATTACTCATACGCATTCAAAGTGTGTTTTCTGTTTATCGTTTGTATCTTTCCTCATCGATACT
TTAGAAAGCCCCGTTGATCCAAATGACACGCAACTCGGATATTATCTCATTTCAACGTGGGCGAAAATTGGTCAA
GCACTCGGCGAAGAGTTTGATCCGTACCTGCCCCTCGTCATGCCCAATATCCTCAAGACGGCGAGCGCCAAGACT
GACATCTCCGTATACGGTATGGTATTTGTTCTCTGGAGGATGCATAGTAATCAACGTGTTTTTAGAAGACGACGA
CGACGACTCTAATACCGAGCGCGAGGGATGGGAGACCGTGACTGTTGATGGGCGAACGATGGGCATCAAAACGTC
GGCCCTGGAAGAGAAATGCCAGGCTTTCGAAACTTTACTCATCTACTGCTCGACACTCGGAGGCAAATACGCTGC
ATACCTGTCGCAGACCCTTGAAATCTGTATACCTTGTCTCAAATTCGATTTTCACGAGGGCGTGAGGGAGGCAAG
TGCTATGTGAGTGCACTCATTCATTATCAAGCAGTCATTCATTTCTCTCTAGGCTGGTTCCTCGTCTCCTCGATT
CTGGCAAGATCTCCAACACACTCACGACGCAGATGGTCACAGCTACTTTTAATCAACTCATCTCGTGTATCCGAT
CCGAACCCGACTCTTCCTTCCTCGCCTCACTCTACAAGTGTTTCACCGAATCACTCCAAGTCATCGGCGGACCCA
CAAATTTACCGCAAGAGTACCACATCGGCATCATCGATGCCACAAAACATCAACTTCAAGCTCTCGCCGACAAAC
GGCGTTCGCGCGCCAACAGGCTGGCTGGGGACCCTGATATTGATAGAGAGGATATTGCGTTGTATGAACAGTTTG
AAGAGTTTGAGTTGCAGGAGATGGATAAATTGTTGAAAGATTTGGATAGGAATCATCCGTTGAGGATTGCGGTTT
CGAGTGTGAGGGAGTTGGGGGTGAATGAGTGGGACGTCGAGGAGGGTGAGGAGACGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail