© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|052090 |
| Gene name | |
| Location | scaffold_2:3377463..3378780 |
| Strand | - |
| Gene length (bp) | 1317 |
| Transcript length (bp) | 750 |
| Coding sequence length (bp) | 750 |
| Protein length (aa) | 250 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF13499 | EF-hand_7 | EF-hand domain pair | 2.2E-07 | 81 | 135 |
| PF13499 | EF-hand_7 | EF-hand domain pair | 2.5E-09 | 144 | 243 |
| PF13405 | EF-hand_6 | EF-hand domain | 9.1E-07 | 144 | 170 |
| PF13202 | EF-hand_5 | EF hand | 2.6E-02 | 80 | 99 |
| PF13202 | EF-hand_5 | EF hand | 1.3E-01 | 121 | 136 |
| PF13202 | EF-hand_5 | EF hand | 9.4E-03 | 147 | 166 |
| PF13202 | EF-hand_5 | EF hand | 1.4E-01 | 222 | 232 |
| PF13833 | EF-hand_8 | EF-hand domain pair | 1.4E-05 | 105 | 139 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5PQ53|PEF1_XENLA | Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 | 18 | 242 | 4.0E-53 |
| sp|O75340|PDCD6_HUMAN | Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 | 77 | 248 | 2.0E-49 |
| sp|P12815|PDCD6_MOUSE | Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 | 77 | 248 | 3.0E-49 |
| sp|Q8BFY6|PEF1_MOUSE | Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 | 38 | 247 | 2.0E-48 |
| sp|Q9UBV8|PEF1_HUMAN | Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 | 68 | 247 | 1.0E-47 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5PQ53|PEF1_XENLA | Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 | 18 | 242 | 4.0E-53 |
| sp|O75340|PDCD6_HUMAN | Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 | 77 | 248 | 2.0E-49 |
| sp|P12815|PDCD6_MOUSE | Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 | 77 | 248 | 3.0E-49 |
| sp|Q8BFY6|PEF1_MOUSE | Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 | 38 | 247 | 2.0E-48 |
| sp|Q9UBV8|PEF1_HUMAN | Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 | 68 | 247 | 1.0E-47 |
| sp|Q641Z8|PEF1_RAT | Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 | 68 | 247 | 1.0E-45 |
| sp|Q6DC93|PEF1_DANRE | Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 | 70 | 247 | 1.0E-42 |
| sp|Q8W4L0|CML49_ARATH | Probable calcium-binding protein CML49 OS=Arabidopsis thaliana GN=CML49 PE=2 SV=1 | 16 | 246 | 8.0E-40 |
| sp|Q94743|SORCN_SCHJA | Sorcin OS=Schistosoma japonicum PE=2 SV=1 | 77 | 248 | 1.0E-39 |
| sp|Q9FYE4|CML50_ARATH | Probable calcium-binding protein CML50 OS=Arabidopsis thaliana GN=CML50 PE=2 SV=1 | 7 | 246 | 3.0E-37 |
| sp|Q6P069|SORCN_MOUSE | Sorcin OS=Mus musculus GN=Sri PE=1 SV=1 | 69 | 248 | 2.0E-35 |
| sp|P30626|SORCN_HUMAN | Sorcin OS=Homo sapiens GN=SRI PE=1 SV=1 | 69 | 248 | 5.0E-35 |
| sp|Q5R4U9|SORCN_PONAB | Sorcin OS=Pongo abelii GN=SRI PE=2 SV=1 | 69 | 248 | 5.0E-35 |
| sp|P05044|SORCN_CRIGR | Sorcin OS=Cricetulus griseus GN=SRI PE=1 SV=1 | 69 | 248 | 1.0E-34 |
| sp|Q8VC88|GRAN_MOUSE | Grancalcin OS=Mus musculus GN=Gca PE=1 SV=1 | 25 | 248 | 3.0E-32 |
| sp|P28676|GRAN_HUMAN | Grancalcin OS=Homo sapiens GN=GCA PE=1 SV=2 | 59 | 248 | 4.0E-28 |
| sp|Q5RAI6|GRAN_PONAB | Grancalcin OS=Pongo abelii GN=GCA PE=2 SV=1 | 31 | 248 | 6.0E-27 |
| sp|Q96L46|CPNS2_HUMAN | Calpain small subunit 2 OS=Homo sapiens GN=CAPNS2 PE=2 SV=2 | 109 | 246 | 1.0E-22 |
| sp|Q9D7J7|CPNS2_MOUSE | Calpain small subunit 2 OS=Mus musculus GN=Capns2 PE=2 SV=1 | 109 | 246 | 3.0E-21 |
| sp|Q9ZQH1|CML48_ARATH | Probable calcium-binding protein CML48 OS=Arabidopsis thaliana GN=CML48 PE=2 SV=2 | 54 | 246 | 8.0E-20 |
| sp|Q92177|CAN3_CHICK | Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 | 109 | 246 | 5.0E-19 |
| sp|P04632|CPNS1_HUMAN | Calpain small subunit 1 OS=Homo sapiens GN=CAPNS1 PE=1 SV=1 | 109 | 246 | 5.0E-19 |
| sp|P53238|PEF1_YEAST | Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEF1 PE=1 SV=2 | 80 | 248 | 6.0E-19 |
| sp|Q9GLG7|CAN3_MACFA | Calpain-3 OS=Macaca fascicularis GN=CAPN3 PE=2 SV=1 | 49 | 246 | 3.0E-18 |
| sp|P20807|CAN3_HUMAN | Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 | 49 | 246 | 4.0E-18 |
| sp|P43368|CAN3_PIG | Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 | 109 | 246 | 5.0E-18 |
| sp|Q9TTH8|CAN3_SHEEP | Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 | 109 | 246 | 7.0E-18 |
| sp|P51186|CAN3_BOVIN | Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 | 109 | 246 | 9.0E-18 |
| sp|P16259|CAN3_RAT | Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 | 109 | 246 | 1.0E-17 |
| sp|Q64691|CAN3_MOUSE | Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 | 109 | 246 | 2.0E-17 |
| sp|P35750|CAN1_PIG | Calpain-1 catalytic subunit OS=Sus scrofa GN=CAPN1 PE=2 SV=3 | 109 | 246 | 3.0E-17 |
| sp|Q5NVS7|CAN1_PONAB | Calpain-1 catalytic subunit OS=Pongo abelii GN=CAPN1 PE=2 SV=1 | 109 | 246 | 5.0E-17 |
| sp|Q9GLG2|CAN1_MACFA | Calpain-1 catalytic subunit OS=Macaca fascicularis GN=CAPN1 PE=2 SV=1 | 109 | 246 | 5.0E-17 |
| sp|P07384|CAN1_HUMAN | Calpain-1 catalytic subunit OS=Homo sapiens GN=CAPN1 PE=1 SV=1 | 109 | 246 | 6.0E-17 |
| sp|Q27970|CAN1_BOVIN | Calpain-1 catalytic subunit OS=Bos taurus GN=CAPN1 PE=1 SV=3 | 107 | 246 | 7.0E-17 |
| sp|Q92178|CAN2_CHICK | Calpain-2 catalytic subunit OS=Gallus gallus GN=CAPN2 PE=2 SV=3 | 109 | 242 | 8.0E-17 |
| sp|A6NHC0|CAN8_HUMAN | Calpain-8 OS=Homo sapiens GN=CAPN8 PE=2 SV=3 | 88 | 246 | 2.0E-16 |
| sp|O35350|CAN1_MOUSE | Calpain-1 catalytic subunit OS=Mus musculus GN=Capn1 PE=1 SV=1 | 109 | 246 | 2.0E-16 |
| sp|P97571|CAN1_RAT | Calpain-1 catalytic subunit OS=Rattus norvegicus GN=Capn1 PE=1 SV=1 | 109 | 246 | 3.0E-16 |
| sp|P06815|CAN1_RABIT | Calpain-1 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN1 PE=1 SV=1 | 109 | 246 | 3.0E-16 |
| sp|Q91VA3|CAN8_MOUSE | Calpain-8 OS=Mus musculus GN=Capn8 PE=1 SV=1 | 53 | 246 | 4.0E-16 |
| sp|Q4V8Q1|CAN11_RAT | Calpain 11 OS=Rattus norvegicus GN=Capn11 PE=2 SV=2 | 109 | 246 | 7.0E-16 |
| sp|Q9VT65|CANB_DROME | Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 | 109 | 246 | 9.0E-16 |
| sp|P06814|CAN2_RABIT | Calpain-2 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN2 PE=1 SV=1 | 111 | 236 | 1.0E-15 |
| sp|Q95YL5|PEFA_DICDI | Penta-EF hand domain-containing protein 1 OS=Dictyostelium discoideum GN=pefA PE=1 SV=1 | 80 | 245 | 1.0E-15 |
| sp|O08529|CAN2_MOUSE | Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=1 SV=4 | 109 | 237 | 1.0E-15 |
| sp|Q07009|CAN2_RAT | Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 | 109 | 236 | 2.0E-15 |
| sp|Q9GLG1|CAN2_MACFA | Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 | 109 | 236 | 3.0E-15 |
| sp|Q27971|CAN2_BOVIN | Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 | 109 | 236 | 3.0E-15 |
| sp|P17655|CAN2_HUMAN | Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 | 109 | 236 | 3.0E-15 |
| sp|Q78EJ9|CAN8_RAT | Calpain-8 OS=Rattus norvegicus GN=Capn8 PE=2 SV=1 | 88 | 246 | 3.0E-15 |
| sp|Q95YL4|PEFB_DICDI | Penta-EF hand domain-containing protein 2 OS=Dictyostelium discoideum GN=pefB PE=1 SV=1 | 76 | 245 | 3.0E-15 |
| sp|P13135|CPNS1_BOVIN | Calpain small subunit 1 OS=Bos taurus GN=CAPNS1 PE=2 SV=1 | 29 | 246 | 4.0E-15 |
| sp|O14815|CAN9_HUMAN | Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 | 91 | 248 | 2.0E-14 |
| sp|P06813|CPNS1_RABIT | Calpain small subunit 1 OS=Oryctolagus cuniculus GN=CAPNS1 PE=1 SV=1 | 37 | 246 | 2.0E-14 |
| sp|Q6J756|CAN11_MOUSE | Calpain-11 OS=Mus musculus GN=Capn11 PE=1 SV=1 | 109 | 246 | 5.0E-14 |
| sp|P43367|CAN2_PIG | Calpain-2 catalytic subunit (Fragment) OS=Sus scrofa GN=CAPN2 PE=2 SV=2 | 109 | 236 | 2.0E-13 |
| sp|P04574|CPNS1_PIG | Calpain small subunit 1 OS=Sus scrofa GN=CAPNS1 PE=1 SV=1 | 37 | 246 | 2.0E-13 |
| sp|P00789|CANX_CHICK | Calpain-1 catalytic subunit OS=Gallus gallus PE=1 SV=2 | 109 | 229 | 2.0E-13 |
| sp|Q64537|CPNS1_RAT | Calpain small subunit 1 OS=Rattus norvegicus GN=Capns1 PE=1 SV=3 | 33 | 246 | 6.0E-13 |
| sp|O88456|CPNS1_MOUSE | Calpain small subunit 1 OS=Mus musculus GN=Capns1 PE=1 SV=1 | 33 | 246 | 2.0E-12 |
| sp|Q9D805|CAN9_MOUSE | Calpain-9 OS=Mus musculus GN=Capn9 PE=2 SV=2 | 91 | 248 | 1.0E-11 |
| sp|Q11002|CANA_DROME | Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 | 109 | 246 | 2.0E-11 |
| sp|O35920|CAN9_RAT | Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 | 91 | 248 | 3.0E-11 |
| sp|Q9FMP5|CDPKH_ARATH | Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 | 77 | 210 | 2.0E-09 |
| sp|Q9ZV15|CDPKK_ARATH | Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 | 77 | 173 | 6.0E-09 |
| sp|Q3E9C0|CDPKY_ARATH | Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 | 77 | 185 | 7.0E-09 |
| sp|A8MX76|CAN14_HUMAN | Calpain-14 OS=Homo sapiens GN=CAPN14 PE=2 SV=2 | 87 | 229 | 4.0E-08 |
| sp|P27730|CAN_SCHMA | Calpain OS=Schistosoma mansoni PE=2 SV=1 | 74 | 243 | 4.0E-08 |
| sp|Q6ZSI9|CAN12_HUMAN | Calpain-12 OS=Homo sapiens GN=CAPN12 PE=2 SV=1 | 111 | 244 | 5.0E-08 |
| sp|Q9UMQ6|CAN11_HUMAN | Calpain-11 OS=Homo sapiens GN=CAPN11 PE=2 SV=2 | 109 | 246 | 1.0E-07 |
| sp|Q9ZSA2|CDPKL_ARATH | Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 | 77 | 185 | 4.0E-07 |
| sp|Q42438|CDPK8_ARATH | Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 | 67 | 159 | 7.0E-07 |
| sp|Q9NZT1|CALL5_HUMAN | Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 | 71 | 189 | 1.0E-06 |
| sp|Q9SZM3|CDPKQ_ARATH | Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 | 77 | 188 | 2.0E-06 |
| sp|Q9S9V0|CDPKV_ARATH | Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 | 77 | 173 | 2.0E-06 |
| sp|Q9ZSA4|CDPKR_ARATH | Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 | 77 | 172 | 5.0E-06 |
| sp|Q38870|CDPK2_ARATH | Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 | 77 | 176 | 7.0E-06 |
| sp|A5A7I8|CDPK5_SOLTU | Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 | 77 | 167 | 9.0E-06 |
| sp|P57796|CABP4_HUMAN | Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 | 24 | 210 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005509 | calcium ion binding | Yes |
| GO:0046872 | metal ion binding | No |
| GO:0003674 | molecular_function | No |
| GO:0043167 | ion binding | No |
| GO:0005488 | binding | No |
| GO:0043169 | cation binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.7031 | 0.2578 | 0.0528 | 0.3226 | 0.0815 | 0.0062 | 0.3191 | 0.5076 | 0.0878 | 0.0331 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 201.18 | 96.31 | 306.04 |
| Initials | Initials knots | 231.92 | 139.16 | 324.68 |
| Pileal_Stipeal_center | Stage I stipe center | 39.36 | 20.50 | 58.22 |
| Pileal_Stipeal_shell | Stage I stipe shell | 103.64 | 60.24 | 147.05 |
| DIF_stipe_center | Stage II stipe center | 61.84 | 34.97 | 88.70 |
| DIF_stipe_shell | Stage II stipe shell | 47.17 | 25.66 | 68.69 |
| DIF_stipe_skin | Stage II stipe skin | 41.19 | 22.13 | 60.25 |
| DIF_cap_skin | Stage II cap skin | 170.74 | 101.24 | 240.23 |
| DIF_cap_tissue | Stage II cap tissue | 153.24 | 87.50 | 218.99 |
| DIF_gill_tissue | Stage II gill tissue | 81.39 | 46.78 | 116.00 |
| YFB_stipe_center | Young fruiting body stipe center | 131.76 | 78.53 | 185.00 |
| YFB_stipe_shell | Young fruiting body stipe shell | 96.53 | 56.43 | 136.64 |
| YFB_stipe_skin | Young fruiting body stipe skin | 34.38 | 17.94 | 50.82 |
| YFB_cap_skin | Young fruiting body cap skin | 156.30 | 93.90 | 218.71 |
| YFB_cap_tissue | Young fruiting body cap tissue | 206.24 | 122.94 | 289.55 |
| YFB_gill_tissue | Young fruiting body gill tissue | 121.33 | 70.91 | 171.75 |
| YFB_veil | Young fruiting body veil | 78.04 | 43.27 | 112.82 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.003765 | yes |
| Casing | YFB_stipe_center | 0.217423 | no |
| Casing | YFB_stipe_shell | 0.021846 | yes |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.525600 | no |
| Casing | YFB_cap_tissue | 0.966600 | no |
| Casing | YFB_gill_tissue | 0.124703 | no |
| Casing | YFB_veil | 0.002525 | yes |
| Casing | Initials | 0.765525 | no |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.035309 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.000613 | yes |
| Casing | DIF_cap_skin | 0.726504 | no |
| Casing | DIF_cap_tissue | 0.499974 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.095802 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.686418 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.002951 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.013782 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.188780 | no |
| DIF_gill_tissue | YFB_veil | 0.941610 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.349727 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_skin | 0.665109 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.111638 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.868437 | no |
| YFB_stipe_center | YFB_veil | 0.072510 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.085561 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.003765 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.537055 | no |
| YFB_stipe_shell | YFB_veil | 0.594743 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_veil | 0.005302 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.399362 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.462059 | no |
| YFB_cap_skin | YFB_veil | 0.011041 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.046117 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.152734 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.032038 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.168680 | no |
| Initials | YFB_cap_tissue | 0.791043 | no |
| Initials | YFB_gill_tissue | 0.011659 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.002525 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.342473 | no |
| Initials | DIF_cap_tissue | 0.155303 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.012274 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.001140 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.794928 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.022369 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.001140 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.170359 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.698087 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.941014 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.512710 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.498651 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.893147 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.155171 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.009446 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.706528 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.424353 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.077879 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.006742 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.075908 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.196757 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.452888 | no |
| DIF_stipe_center | YFB_stipe_center | 0.006387 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.140843 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.055182 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.012577 | yes |
| DIF_stipe_center | YFB_veil | 0.556761 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.482694 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.224601 | no |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.001625 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.068461 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_shell | 0.011659 | yes |
| DIF_stipe_shell | YFB_stipe_skin | 0.408913 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.105864 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.783711 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.020790 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.001140 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.700733 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_veil | 0.034604 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.003765 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.441983 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.034604 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.851371 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.615560 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.268263 | no |
| DIF_cap_skin | YFB_veil | 0.004548 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.814860 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.021056 | yes |
| DIF_cap_tissue | YFB_stipe_center | 0.723458 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.108546 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.971815 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.368389 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.521216 | no |
| DIF_cap_tissue | YFB_veil | 0.015529 | yes |
| Orthofinder run ID | 1 |
| Orthogroup | 619 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|052090 MSYGGNYGSGGGFPPPAGRPTQGGGYGGPPGGGFGGSPGGGYGGPPGAGYGGASGYGGGFSAPQQSHGPPPGADP QLWNWFTAVDTDRSNHITAPELERALINGDWTPFDLDTVKLLMTIFDTDRSGTIGFNEFSGLWKYIKDWQNVFRH FDRDRSGSIDGGELQQALHQFGFNLAPPMIELVQKKYDVKASATQMPGAPVPGISFDRFVRACVVVKQLTEAFQK LDTDRDGWVQISYDQFMQTVLSLP* |
| Coding | >AgabiH97|052090 ATGTCTTACGGAGGAAACTATGGTAGTGGTGGTGGATTCCCACCTCCCGCAGGACGACCTACCCAGGGCGGCGGT TACGGTGGACCTCCCGGGGGAGGGTTTGGAGGATCGCCCGGTGGTGGATATGGAGGACCACCTGGTGCAGGATAT GGCGGTGCTTCTGGCTACGGAGGAGGATTTTCTGCACCTCAACAAAGTCATGGACCACCGCCTGGTGCTGATCCT CAGCTTTGGAATTGGTTCACCGCCGTAGATACGGATAGATCTAACCATATAACTGCACCCGAGCTTGAGAGAGCG CTCATCAATGGCGATTGGACTCCTTTCGACTTGGATACCGTTAAATTGCTTATGACGATCTTCGATACCGATCGT AGTGGGACTATCGGATTCAACGAATTTTCTGGGCTTTGGAAGTACATCAAGGACTGGCAAAATGTCTTTAGACAC TTTGATCGCGACCGATCTGGTTCCATCGACGGTGGAGAGCTTCAACAGGCCCTCCATCAATTTGGTTTCAATTTA GCGCCTCCAATGATTGAACTCGTACAGAAGAAATACGACGTCAAAGCTTCCGCCACACAAATGCCTGGTGCTCCA GTTCCAGGAATCTCGTTTGATCGTTTCGTACGGGCTTGCGTCGTCGTCAAGCAACTCACCGAGGCGTTCCAAAAG CTTGATACCGACCGAGATGGATGGGTTCAAATAAGTTATGATCAGTTTATGCAAACCGTACTCAGCTTGCCCTGA |
| Transcript | >AgabiH97|052090 ATGTCTTACGGAGGAAACTATGGTAGTGGTGGTGGATTCCCACCTCCCGCAGGACGACCTACCCAGGGCGGCGGT TACGGTGGACCTCCCGGGGGAGGGTTTGGAGGATCGCCCGGTGGTGGATATGGAGGACCACCTGGTGCAGGATAT GGCGGTGCTTCTGGCTACGGAGGAGGATTTTCTGCACCTCAACAAAGTCATGGACCACCGCCTGGTGCTGATCCT CAGCTTTGGAATTGGTTCACCGCCGTAGATACGGATAGATCTAACCATATAACTGCACCCGAGCTTGAGAGAGCG CTCATCAATGGCGATTGGACTCCTTTCGACTTGGATACCGTTAAATTGCTTATGACGATCTTCGATACCGATCGT AGTGGGACTATCGGATTCAACGAATTTTCTGGGCTTTGGAAGTACATCAAGGACTGGCAAAATGTCTTTAGACAC TTTGATCGCGACCGATCTGGTTCCATCGACGGTGGAGAGCTTCAACAGGCCCTCCATCAATTTGGTTTCAATTTA GCGCCTCCAATGATTGAACTCGTACAGAAGAAATACGACGTCAAAGCTTCCGCCACACAAATGCCTGGTGCTCCA GTTCCAGGAATCTCGTTTGATCGTTTCGTACGGGCTTGCGTCGTCGTCAAGCAACTCACCGAGGCGTTCCAAAAG CTTGATACCGACCGAGATGGATGGGTTCAAATAAGTTATGATCAGTTTATGCAAACCGTACTCAGCTTGCCCTGA |
| Gene | >AgabiH97|052090 ATGTCTTACGGAGGAGTGAGTGTTCTACCCCAGCAGACTGTGTTTTTCTTGAGCGGGTTGTAGAACTATGGTAGT GGTGGTGGATTCCCACCTCCCGCAGGACGACCTACCCAGGGCGGCGGTTACGGTGGACCTCCCGGGGGAGGGTTT GGAGGATCGCCCGGTGGTGGATATGGAGGACCACCTGGTGCAGGATATGGCGGTGCTTCTGTCAGTGTCTCTTCT CGTTGATTTCTTGCACGCATGAAGAAAAGATCAGCTGATAATTGTCTTGTGATTCAGGGCTACGGAGGAGGATTT TCTGCACCTCAACAAAGTCATGGACCACCGCCTGGTGCTGATCCTCAGTTAGTGCGCTTTCTAGTCCATCTCAGA ATATGACTAATGGACGTTGCTTTTTGTTTTTTCAAGGCTTTGGAATTGGTTCACCGCCGTAGATACGGATAGATC TAACCATATAACTGCACCCGAGCTTGGTCTGTTCTTCTTGCTATTGGTGTGACGACTCGCGTTACTTATGATTTG ATTCAGAGAGAGCGCTCATCAATGGCGATTGGACTCGTGAGTTTCGGATGTAGTATGGGAAGTCTCAGATTGCTT AATGAGCTGCCGGATTAGCTTTCGACTTGGATACCGTTAAATTGCTTATGACGATCTTCGTAAGTAATCCTCCGA TAGACATGTGAAACTGCTGATAACGGGATATAGGATACCGATCGTAGTGGGACTATCGGATTCAACGAAGTCAGT CGATTTCATCAGTCACAAGACGCCGAGGACTCAATGTTATTATAGTTTTCTGGGCTTTGGAAGTACATCAAGGTA TATCGGATTGTTGATTTAGCGTCAGGTGAACTCTAAAGCGGTGATTAGGACTGGCAAAATGTCTTTAGACACTTT GATCGCGACCGATCTGGTTCCATCGACGGTGGAGAGCTTCAACAGGCCCTCCATCAATTTGGGTGCGTAGATCTT TAAAAATATATTGCCTTCACTCACGAGTGCTGATATCATTTATTTATAGTTTCAATTTAGCGCCTCCAATGATTG AACTCGTACAGAAGAAATACGGTGAGTCTCTCTTCATGTTGGCTGTCATATTTTGGATTAGTCGAACGCTCACAC TTAGACGTCAAAGCTTCCGCCACACAAATGCCTGGTGCTCCAGTTCCAGGAATCTCGTTTGATCGTTTCGTACGG GCTTGCGTCGTCGTCAAGCAACTCACCGAGGCGTTCCAAAAGCTTGATACCGACCGAGATGGATGGGTTCAAATA AGTTATGATCAGTTTATGCAAACCGTACTCAGCTTGCCCTGA |