Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051910
Gene name
Locationscaffold_2:3331988..3332683
Strand-
Gene length (bp)695
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P83811|CAP_COPCM Antiviral protein CAP (Fragment) OS=Coprinus comatus PE=1 SV=1 54 144 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 13.95 5.11 22.79
Initials Initials knots 11.91 3.53 20.28
Pileal_Stipeal_center Stage I stipe center 8.99 2.42 15.57
Pileal_Stipeal_shell Stage I stipe shell 0.25 0.00 0.78
DIF_stipe_center Stage II stipe center 2.94 0.49 5.40
DIF_stipe_shell Stage II stipe shell 3.75 0.76 6.75
DIF_stipe_skin Stage II stipe skin 6.35 1.84 10.86
DIF_cap_skin Stage II cap skin 0.90 0.00 2.00
DIF_cap_tissue Stage II cap tissue 0.60 0.00 1.43
DIF_gill_tissue Stage II gill tissue 1.10 0.00 2.36
YFB_stipe_center Young fruiting body stipe center 5.19 1.06 9.31
YFB_stipe_shell Young fruiting body stipe shell 2.08 0.18 3.98
YFB_stipe_skin Young fruiting body stipe skin 4.30 0.95 7.64
YFB_cap_skin Young fruiting body cap skin 0.00 0.00 0.00
YFB_cap_tissue Young fruiting body cap tissue 0.06 0.00 0.27
YFB_gill_tissue Young fruiting body gill tissue 0.31 0.00 0.71
YFB_veil Young fruiting body veil 0.48 0.00 1.20

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.005302 yes
Casing YFB_stipe_center 0.048422 yes
Casing YFB_stipe_shell 0.002084 yes
Casing YFB_stipe_skin 0.016104 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.494252 no
Casing YFB_gill_tissue 0.190257 no
Casing YFB_veil 0.058732 no
Casing Initials 0.833897 no
Casing Pileal_Stipeal_center 0.429326 no
Casing Pileal_Stipeal_shell 0.236256 no
Casing DIF_stipe_center 0.002084 yes
Casing DIF_stipe_shell 0.011350 yes
Casing DIF_stipe_skin 0.106349 no
Casing DIF_cap_skin 0.004548 yes
Casing DIF_cap_tissue 0.016386 yes
DIF_gill_tissue YFB_stipe_center 0.049257 yes
DIF_gill_tissue YFB_stipe_shell 0.496751 no
DIF_gill_tissue YFB_stipe_skin 0.081927 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.494685 no
DIF_gill_tissue YFB_gill_tissue 0.399990 no
DIF_gill_tissue YFB_veil 0.526593 no
YFB_stipe_center YFB_stipe_shell 0.156514 no
YFB_stipe_center YFB_stipe_skin 0.846744 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.494252 no
YFB_stipe_center YFB_gill_tissue 0.190257 no
YFB_stipe_center YFB_veil 0.074661 no
YFB_stipe_shell YFB_stipe_skin 0.280365 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.494252 no
YFB_stipe_shell YFB_gill_tissue 0.242550 no
YFB_stipe_shell YFB_veil 0.195326 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.494252 no
YFB_stipe_skin YFB_gill_tissue 0.191686 no
YFB_stipe_skin YFB_veil 0.080353 no
YFB_cap_skin YFB_cap_tissue 1.000000 no
YFB_cap_skin YFB_gill_tissue 1.000000 no
YFB_cap_skin YFB_veil 0.032742 yes
YFB_cap_tissue YFB_gill_tissue 1.000000 no
YFB_cap_tissue YFB_veil 0.513034 no
YFB_gill_tissue YFB_veil 0.835968 no
Initials DIF_gill_tissue 0.006387 yes
Initials YFB_stipe_center 0.125429 no
Initials YFB_stipe_shell 0.004160 yes
Initials YFB_stipe_skin 0.047373 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.494252 no
Initials YFB_gill_tissue 0.190257 no
Initials YFB_veil 0.058732 no
Initials Pileal_Stipeal_center 0.688376 no
Initials Pileal_Stipeal_shell 0.236256 no
Initials DIF_stipe_center 0.006742 yes
Initials DIF_stipe_shell 0.027451 yes
Initials DIF_stipe_skin 0.253995 no
Initials DIF_cap_skin 0.008121 yes
Initials DIF_cap_tissue 0.016669 yes
Pileal_Stipeal_center DIF_gill_tissue 0.012274 yes
Pileal_Stipeal_center YFB_stipe_center 0.361113 no
Pileal_Stipeal_center YFB_stipe_shell 0.014956 yes
Pileal_Stipeal_center YFB_stipe_skin 0.181690 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.494252 no
Pileal_Stipeal_center YFB_gill_tissue 0.190257 no
Pileal_Stipeal_center YFB_veil 0.059121 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.236256 no
Pileal_Stipeal_center DIF_stipe_center 0.038278 yes
Pileal_Stipeal_center DIF_stipe_shell 0.110389 no
Pileal_Stipeal_center DIF_stipe_skin 0.599848 no
Pileal_Stipeal_center DIF_cap_skin 0.012274 yes
Pileal_Stipeal_center DIF_cap_tissue 0.016949 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.336225 no
Pileal_Stipeal_shell YFB_stipe_center 0.234408 no
Pileal_Stipeal_shell YFB_stipe_shell 0.239759 no
Pileal_Stipeal_shell YFB_stipe_skin 0.234408 no
Pileal_Stipeal_shell YFB_cap_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_tissue 1.000000 no
Pileal_Stipeal_shell YFB_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_veil 0.775970 no
Pileal_Stipeal_shell DIF_stipe_center 0.234848 no
Pileal_Stipeal_shell DIF_stipe_shell 0.234408 no
Pileal_Stipeal_shell DIF_stipe_skin 0.234408 no
Pileal_Stipeal_shell DIF_cap_skin 0.411559 no
Pileal_Stipeal_shell DIF_cap_tissue 0.603994 no
DIF_stipe_center DIF_gill_tissue 0.207281 no
DIF_stipe_center YFB_stipe_center 0.410324 no
DIF_stipe_center YFB_stipe_shell 0.693722 no
DIF_stipe_center YFB_stipe_skin 0.635820 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.494252 no
DIF_stipe_center YFB_gill_tissue 0.203875 no
DIF_stipe_center YFB_veil 0.119615 no
DIF_stipe_center DIF_stipe_shell 0.791099 no
DIF_stipe_center DIF_stipe_skin 0.195928 no
DIF_stipe_center DIF_cap_skin 0.155976 no
DIF_stipe_center DIF_cap_tissue 0.098771 no
DIF_stipe_shell DIF_gill_tissue 0.108390 no
DIF_stipe_shell YFB_stipe_center 0.699220 no
DIF_stipe_shell YFB_stipe_shell 0.422572 no
DIF_stipe_shell YFB_stipe_skin 0.898073 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.494252 no
DIF_stipe_shell YFB_gill_tissue 0.193505 no
DIF_stipe_shell YFB_veil 0.098442 no
DIF_stipe_shell DIF_stipe_skin 0.421783 no
DIF_stipe_shell DIF_cap_skin 0.089301 no
DIF_stipe_shell DIF_cap_tissue 0.061086 no
DIF_stipe_skin DIF_gill_tissue 0.025711 yes
DIF_stipe_skin YFB_stipe_center 0.818786 no
DIF_stipe_skin YFB_stipe_shell 0.063376 no
DIF_stipe_skin YFB_stipe_skin 0.585544 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.494252 no
DIF_stipe_skin YFB_gill_tissue 0.190257 no
DIF_stipe_skin YFB_veil 0.062995 no
DIF_stipe_skin DIF_cap_skin 0.025711 yes
DIF_stipe_skin DIF_cap_tissue 0.028675 yes
DIF_cap_skin DIF_gill_tissue 0.901014 no
DIF_cap_skin YFB_stipe_center 0.038495 yes
DIF_cap_skin YFB_stipe_shell 0.354048 no
DIF_cap_skin YFB_stipe_skin 0.066584 no
DIF_cap_skin YFB_cap_skin 0.001625 yes
DIF_cap_skin YFB_cap_tissue 0.495089 no
DIF_cap_skin YFB_gill_tissue 0.511055 no
DIF_cap_skin YFB_veil 0.659199 no
DIF_cap_skin DIF_cap_tissue 0.762726 no
DIF_cap_tissue DIF_gill_tissue 0.618630 no
DIF_cap_tissue YFB_stipe_center 0.039612 yes
DIF_cap_tissue YFB_stipe_shell 0.190974 no
DIF_cap_tissue YFB_stipe_skin 0.049257 yes
DIF_cap_tissue YFB_cap_skin 0.006742 yes
DIF_cap_tissue YFB_cap_tissue 0.501761 no
DIF_cap_tissue YFB_gill_tissue 0.738742 no
DIF_cap_tissue YFB_veil 0.897695 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051910
MLKGSQEPLVQLNHLTMFFKAYLVASTLLTVAAAQDSLTCFQGPPTAAGPATDCTPFVDEFCDSVGLVNMRTNDS
ITRCFELPNDNVCDLGAYNTLMVDIAPSVVNCKAILTSAISQCNLGGFGKAAPVAYTFTVDVNHAKCGTLHTGS*
Coding >AgabiH97|051910
ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCTACCTCGTCGCA
TCGACTCTCCTCACCGTAGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCT
GCCACTGACTGCACCCCATTTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATATGCGTACCAATGATTCA
ATCACTCGCTGCTTCGAGTTACCGAATGACAACGTTTGCGATCTTGGGGCATATAATACATTAATGGTTGATATC
GCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAGCGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG
GCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCACTCTGCATACTGGGTCCTAA
Transcript >AgabiH97|051910
ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCTACCTCGTCGCA
TCGACTCTCCTCACCGTAGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCT
GCCACTGACTGCACCCCATTTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATATGCGTACCAATGATTCA
ATCACTCGCTGCTTCGAGTTACCGAATGACAACGTTTGCGATCTTGGGGCATATAATACATTAATGGTTGATATC
GCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAGCGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG
GCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCACTCTGCATACTGGGTCCTAA
Gene >AgabiH97|051910
ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCGTACGTCCACGA
CGGTGATGGTGGAATTTCGATCAACTGACTGGGTACATCTGTAGTACCTCGTCGCATCGACTCTCCTCACCGTAG
CAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCTGCCACTGACTGCACCCCAT
TTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATGTAAGTACTACTAAGTCAGCACTGTTCCTCGAAACTG
ACCAGCGAGATTACCCATGTTCCCCAAGATGCGTACCAATGATTCAATCACTCGCTGCTTCGAGTTACCGAATGA
CAACGTTTGTGAGTAGTATTCTTGGTGGTTCTACCCTCAGTAGTATCGGCTACTCATGGCGCATATCATGATAGG
CGATCTTGGGGCATATAATACATTAATGGTTGATATCGCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAG
CGCTATCTCTCAATGCAACTTGGTAAATTTCGTGTATATTCGAACTATCATACTGAAAATTTACTGATGACGAAA
TCCAGGGTGGTTTTGGAAAGGCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCA
CTCTGCATACTGGGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail