© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|051910 |
| Gene name | |
| Location | scaffold_2:3331988..3332683 |
| Strand | - |
| Gene length (bp) | 695 |
| Transcript length (bp) | 450 |
| Coding sequence length (bp) | 450 |
| Protein length (aa) | 150 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P83811|CAP_COPCM | Antiviral protein CAP (Fragment) OS=Coprinus comatus PE=1 SV=1 | 54 | 144 | 2.0E-09 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 35 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 13.95 | 5.11 | 22.79 |
| Initials | Initials knots | 11.91 | 3.53 | 20.28 |
| Pileal_Stipeal_center | Stage I stipe center | 8.99 | 2.42 | 15.57 |
| Pileal_Stipeal_shell | Stage I stipe shell | 0.25 | 0.00 | 0.78 |
| DIF_stipe_center | Stage II stipe center | 2.94 | 0.49 | 5.40 |
| DIF_stipe_shell | Stage II stipe shell | 3.75 | 0.76 | 6.75 |
| DIF_stipe_skin | Stage II stipe skin | 6.35 | 1.84 | 10.86 |
| DIF_cap_skin | Stage II cap skin | 0.90 | 0.00 | 2.00 |
| DIF_cap_tissue | Stage II cap tissue | 0.60 | 0.00 | 1.43 |
| DIF_gill_tissue | Stage II gill tissue | 1.10 | 0.00 | 2.36 |
| YFB_stipe_center | Young fruiting body stipe center | 5.19 | 1.06 | 9.31 |
| YFB_stipe_shell | Young fruiting body stipe shell | 2.08 | 0.18 | 3.98 |
| YFB_stipe_skin | Young fruiting body stipe skin | 4.30 | 0.95 | 7.64 |
| YFB_cap_skin | Young fruiting body cap skin | 0.00 | 0.00 | 0.00 |
| YFB_cap_tissue | Young fruiting body cap tissue | 0.06 | 0.00 | 0.27 |
| YFB_gill_tissue | Young fruiting body gill tissue | 0.31 | 0.00 | 0.71 |
| YFB_veil | Young fruiting body veil | 0.48 | 0.00 | 1.20 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.005302 | yes |
| Casing | YFB_stipe_center | 0.048422 | yes |
| Casing | YFB_stipe_shell | 0.002084 | yes |
| Casing | YFB_stipe_skin | 0.016104 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.494252 | no |
| Casing | YFB_gill_tissue | 0.190257 | no |
| Casing | YFB_veil | 0.058732 | no |
| Casing | Initials | 0.833897 | no |
| Casing | Pileal_Stipeal_center | 0.429326 | no |
| Casing | Pileal_Stipeal_shell | 0.236256 | no |
| Casing | DIF_stipe_center | 0.002084 | yes |
| Casing | DIF_stipe_shell | 0.011350 | yes |
| Casing | DIF_stipe_skin | 0.106349 | no |
| Casing | DIF_cap_skin | 0.004548 | yes |
| Casing | DIF_cap_tissue | 0.016386 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.049257 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.496751 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.081927 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.494685 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.399990 | no |
| DIF_gill_tissue | YFB_veil | 0.526593 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.156514 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.846744 | no |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.494252 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.190257 | no |
| YFB_stipe_center | YFB_veil | 0.074661 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.280365 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.494252 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.242550 | no |
| YFB_stipe_shell | YFB_veil | 0.195326 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.494252 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.191686 | no |
| YFB_stipe_skin | YFB_veil | 0.080353 | no |
| YFB_cap_skin | YFB_cap_tissue | 1.000000 | no |
| YFB_cap_skin | YFB_gill_tissue | 1.000000 | no |
| YFB_cap_skin | YFB_veil | 0.032742 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 1.000000 | no |
| YFB_cap_tissue | YFB_veil | 0.513034 | no |
| YFB_gill_tissue | YFB_veil | 0.835968 | no |
| Initials | DIF_gill_tissue | 0.006387 | yes |
| Initials | YFB_stipe_center | 0.125429 | no |
| Initials | YFB_stipe_shell | 0.004160 | yes |
| Initials | YFB_stipe_skin | 0.047373 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.494252 | no |
| Initials | YFB_gill_tissue | 0.190257 | no |
| Initials | YFB_veil | 0.058732 | no |
| Initials | Pileal_Stipeal_center | 0.688376 | no |
| Initials | Pileal_Stipeal_shell | 0.236256 | no |
| Initials | DIF_stipe_center | 0.006742 | yes |
| Initials | DIF_stipe_shell | 0.027451 | yes |
| Initials | DIF_stipe_skin | 0.253995 | no |
| Initials | DIF_cap_skin | 0.008121 | yes |
| Initials | DIF_cap_tissue | 0.016669 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.012274 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.361113 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.014956 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.181690 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.494252 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.190257 | no |
| Pileal_Stipeal_center | YFB_veil | 0.059121 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.236256 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.038278 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.110389 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.599848 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.012274 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.016949 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.336225 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.234408 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.239759 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.234408 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 1.000000 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 1.000000 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 1.000000 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.775970 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.234848 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.234408 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.234408 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.411559 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.603994 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.207281 | no |
| DIF_stipe_center | YFB_stipe_center | 0.410324 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.693722 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.635820 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.494252 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.203875 | no |
| DIF_stipe_center | YFB_veil | 0.119615 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.791099 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.195928 | no |
| DIF_stipe_center | DIF_cap_skin | 0.155976 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.098771 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.108390 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.699220 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.422572 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.898073 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.494252 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.193505 | no |
| DIF_stipe_shell | YFB_veil | 0.098442 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.421783 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.089301 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.061086 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.025711 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.818786 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.063376 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.585544 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.494252 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.190257 | no |
| DIF_stipe_skin | YFB_veil | 0.062995 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.025711 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.028675 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.901014 | no |
| DIF_cap_skin | YFB_stipe_center | 0.038495 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.354048 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.066584 | no |
| DIF_cap_skin | YFB_cap_skin | 0.001625 | yes |
| DIF_cap_skin | YFB_cap_tissue | 0.495089 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.511055 | no |
| DIF_cap_skin | YFB_veil | 0.659199 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.762726 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.618630 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.039612 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.190974 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.049257 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.006742 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.501761 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.738742 | no |
| DIF_cap_tissue | YFB_veil | 0.897695 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|051910 MLKGSQEPLVQLNHLTMFFKAYLVASTLLTVAAAQDSLTCFQGPPTAAGPATDCTPFVDEFCDSVGLVNMRTNDS ITRCFELPNDNVCDLGAYNTLMVDIAPSVVNCKAILTSAISQCNLGGFGKAAPVAYTFTVDVNHAKCGTLHTGS* |
| Coding | >AgabiH97|051910 ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCTACCTCGTCGCA TCGACTCTCCTCACCGTAGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCT GCCACTGACTGCACCCCATTTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATATGCGTACCAATGATTCA ATCACTCGCTGCTTCGAGTTACCGAATGACAACGTTTGCGATCTTGGGGCATATAATACATTAATGGTTGATATC GCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAGCGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG GCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCACTCTGCATACTGGGTCCTAA |
| Transcript | >AgabiH97|051910 ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCTACCTCGTCGCA TCGACTCTCCTCACCGTAGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCT GCCACTGACTGCACCCCATTTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATATGCGTACCAATGATTCA ATCACTCGCTGCTTCGAGTTACCGAATGACAACGTTTGCGATCTTGGGGCATATAATACATTAATGGTTGATATC GCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAGCGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG GCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCACTCTGCATACTGGGTCCTAA |
| Gene | >AgabiH97|051910 ATGCTCAAAGGATCGCAAGAACCTCTCGTGCAACTCAACCACCTCACAATGTTTTTCAAAGCCGTACGTCCACGA CGGTGATGGTGGAATTTCGATCAACTGACTGGGTACATCTGTAGTACCTCGTCGCATCGACTCTCCTCACCGTAG CAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCCACTGCTGCGGGTCCTGCCACTGACTGCACCCCAT TTGTGGACGAATTTTGCGACTCGGTTGGTTTGGTCAATGTAAGTACTACTAAGTCAGCACTGTTCCTCGAAACTG ACCAGCGAGATTACCCATGTTCCCCAAGATGCGTACCAATGATTCAATCACTCGCTGCTTCGAGTTACCGAATGA CAACGTTTGTGAGTAGTATTCTTGGTGGTTCTACCCTCAGTAGTATCGGCTACTCATGGCGCATATCATGATAGG CGATCTTGGGGCATATAATACATTAATGGTTGATATCGCACCCTCTGTGGTCAATTGCAAAGCCATACTGACCAG CGCTATCTCTCAATGCAACTTGGTAAATTTCGTGTATATTCGAACTATCATACTGAAAATTTACTGATGACGAAA TCCAGGGTGGTTTTGGAAAGGCTGCTCCCGTTGCGTATACCTTCACGGTTGACGTTAACCATGCAAAATGCGGCA CTCTGCATACTGGGTCCTAA |