Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051810
Gene name
Locationscaffold_2:3302200..3307035
Strand+
Gene length (bp)4835
Transcript length (bp)3369
Coding sequence length (bp)3369
Protein length (aa) 1123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 9.7E-57 319 715
PF00027 cNMP_binding Cyclic nucleotide-binding domain 7.3E-12 994 1077
PF01740 STAS STAS domain 1.1E-10 778 886

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.11c PE=3 SV=1 320 1101 2.0E-179
sp|P53273|YG35_YEAST Uncharacterized vacuolar membrane protein YGR125W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR125W PE=1 SV=1 320 1102 2.0E-143
sp|Q14SY0|BICA_SYNP2 Bicarbonate transporter BicA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bicA PE=1 SV=1 611 793 4.0E-07
sp|P55189|YBAR_BACSU Putative sulfate transporter YbaR OS=Bacillus subtilis (strain 168) GN=ybaR PE=3 SV=2 421 751 6.0E-06

GO

GO Term Description Terminal node
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015698 inorganic anion transport No
GO:0072348 sulfur compound transport No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 313 335 22
2 339 361 22
3 374 396 22
4 411 433 22
5 440 462 22
6 494 511 17
7 518 540 22
8 573 595 22
9 626 648 22
10 668 690 22
11 711 733 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051810
MPEDRSSSKAFANSRPDHAFNISPLSDSSLHRAGLLRPMSYNPSSPLTGRFLPGSLPISHRIPHQHSQRSIRLTT
MQLSNMPASYPQNIDSVLLGGMPLSAPSDSQGLCRQHNTSYHSLQQDPRKDDSLATLPLSSDDNPARSLTLSPND
TDIPNSNLITPTAIAQSPSASNVTSGMSASEANWEATTEPYTSPALSSPLRQECRVSSPPSPSTSGTITPTGPPN
APDEYENVSGPAAWFKDPNSLLQVSERTSLLPPTSHHEPHSQNGYGTPEIRLSTPETESTDFLLLHYDGIPAWKK
VVRKTLHDIPVKSRMVLSAIPAVLLGTLINILDGISYGMIIFPSTGVFADLGSMGVSLFFVSTIAVQFTYTLGGS
SFAGANGSMMIEVVPFFHMIANSIASEIGEEHPREIIATTLVAFAASSILTGLCFFLLGLLKLGTIVGLFPRHIL
VGCIGGIGAFLIQTGLTVSMHMSEEDFTMSFETLKTMFLDHHMLLLWTIPFALAVLLRIITHKFHHQLVFPLYFL
VIPIIFYIVVASARLDLNKLRTENWLFDVGSASETPWYHYFSYLDHRLIRFGALWSTLPTQFALLFFNILHPPLN
VPALAVSLDCECDTNKELMGHGYSNLLSGLIGSVPNYLVYVNTLLFYRVGGDNRVAGFLLALSTCVLLFIGVGPI
AYIPVMVVGALIFVLGIDLVKEALWDTRHRVSRVEYVTIIGIMIVMTAWDFVTGVLFGIVVSCFFFVVQNSQVDC
IRSIYTGDTAMSAVRRSGLQRAYIREVAKHTTILRLQGFLFFGTISRVEETIKGLFEAPSWQKNPIQFLVVDMVH
VAGVDMSAAEAFVRIQRLLFAKRVVLVFCGFSDDSVVGKALQNVGVLDAEGVELFSTFNDAMEWTENEYLHSWFR
SHPLEPPRTLLPVPVRRDPSWDVHHIADPFAVSPRRSHIWDVGNKTIGIEFDSNLSEADLTSNPLNTLSRAFPWG
SDDAQKFKGIVRYFSRLIVPTGHILWKQDDSPDGLYIVESGVLRATYKFRNQTQSLEETMVSGTIAGELSALSSL
PRNATCIVEHHATLWKMSMQDLDKLRRDEPALSAWFIQLILKAGKTDYDILLSAVASFGLVFELASCDTPRA*
Coding >AgabiH97|051810
ATGCCTGAAGACAGATCATCTTCCAAGGCCTTTGCCAATTCTCGTCCTGACCACGCCTTCAATATTTCGCCCCTA
TCCGACTCCTCATTGCACCGAGCAGGGCTTCTGCGGCCAATGTCTTATAATCCTTCTAGTCCGCTCACTGGCCGC
TTCCTCCCAGGCTCCCTTCCTATAAGTCACAGGATCCCTCATCAGCACTCCCAACGTTCTATTCGACTCACAACA
ATGCAACTGTCTAATATGCCCGCGTCTTATCCTCAAAATATTGATTCCGTCCTTCTCGGCGGGATGCCTCTATCT
GCGCCATCTGATTCTCAGGGTCTGTGCCGTCAACATAATACTTCATATCATTCACTCCAACAAGACCCTCGCAAA
GATGATTCTCTTGCTACCCTTCCCTTATCTTCTGATGATAATCCCGCTCGTTCTCTCACACTATCACCTAATGAC
ACCGACATCCCCAACTCCAACTTAATTACCCCGACTGCAATTGCCCAATCACCTTCAGCATCAAACGTGACCTCC
GGTATGTCGGCCAGTGAGGCCAACTGGGAAGCAACGACTGAGCCTTATACCAGTCCTGCTCTTTCAAGTCCTCTT
CGTCAAGAATGCCGTGTCTCATCCCCTCCATCACCTTCGACCTCTGGTACAATTACACCTACTGGTCCTCCTAAC
GCACCTGACGAATATGAAAACGTATCTGGTCCGGCGGCCTGGTTTAAAGATCCGAACTCGCTATTACAAGTATCG
GAAAGGACATCATTATTACCACCCACCTCGCATCACGAACCCCACTCACAAAATGGGTATGGGACTCCCGAAATT
CGTCTCTCAACACCTGAAACAGAGAGCACTGATTTTCTACTTTTACACTACGACGGGATTCCAGCTTGGAAGAAG
GTCGTTAGAAAAACATTACATGATATACCCGTCAAGTCAAGAATGGTGTTGTCCGCAATCCCCGCCGTCTTACTT
GGCACTTTGATCAACATCCTTGACGGCATTAGCTACGGGATGATTATATTTCCCTCAACTGGAGTTTTTGCCGAC
CTGGGCTCGATGGGCGTTTCTTTGTTCTTCGTCTCAACCATAGCTGTCCAGTTCACGTATACGCTCGGAGGAAGC
TCATTTGCTGGAGCCAATGGTAGTATGATGATTGAAGTGGTGCCTTTTTTCCATATGATCGCAAACAGCATAGCC
TCGGAGATCGGAGAAGAACACCCGAGAGAAATCATTGCCACAACGTTGGTTGCATTCGCCGCCAGTTCTATCTTG
ACAGGATTATGCTTTTTCCTGTTGGGTTTATTGAAACTCGGGACGATTGTGGGGCTTTTCCCTCGTCACATCCTC
GTCGGATGTATCGGCGGGATTGGGGCATTTCTTATTCAAACAGGTTTGACTGTCAGCATGCATATGAGCGAAGAA
GATTTCACAATGTCTTTCGAAACTTTAAAAACCATGTTTTTGGACCATCACATGTTACTGTTATGGACAATTCCT
TTTGCCTTGGCAGTTCTACTTAGAATCATCACACACAAATTTCACCATCAGCTTGTATTTCCTCTTTATTTCCTT
GTTATACCCATTATTTTCTATATCGTTGTTGCCTCTGCTAGACTGGACTTAAATAAGCTTCGGACGGAAAACTGG
TTATTCGACGTAGGGAGTGCATCCGAGACGCCTTGGTATCATTACTTTTCTTATCTAGATCATCGCTTAATTCGA
TTTGGCGCATTGTGGTCTACGCTCCCGACTCAATTTGCTCTGCTATTTTTTAATATTTTGCACCCACCTCTGAAC
GTGCCTGCTTTAGCCGTTTCCCTTGATTGTGAATGTGACACGAATAAAGAGTTGATGGGGCATGGCTATTCTAAC
CTCTTATCTGGCCTTATCGGAAGCGTACCCAATTATCTTGTTTATGTGAACACACTTCTATTTTATCGAGTCGGA
GGCGATAACCGTGTTGCGGGGTTTTTGCTTGCTCTATCAACATGCGTCCTCCTTTTCATCGGGGTCGGCCCGATA
GCTTACATCCCTGTTATGGTTGTTGGAGCTTTGATTTTCGTGCTTGGCATTGATTTGGTGAAAGAAGCGTTATGG
GATACCCGACATCGAGTTAGCAGAGTGGAATATGTCACAATTATCGGCATAATGATAGTTATGACCGCTTGGGAC
TTCGTGACAGGCGTTTTGTTTGGTATCGTCGTTAGCTGTTTCTTCTTCGTCGTGCAAAATTCGCAGGTCGATTGT
ATTCGGTCAATTTATACTGGTGATACGGCTATGTCAGCTGTACGTCGATCAGGCTTGCAGCGCGCCTACATTCGA
GAAGTTGCGAAGCACACCACTATTCTCCGTCTTCAGGGTTTCCTTTTCTTTGGAACTATATCGCGCGTTGAAGAA
ACCATAAAGGGTCTCTTCGAAGCGCCTTCTTGGCAGAAAAATCCTATCCAATTCCTGGTTGTTGATATGGTTCAC
GTAGCGGGTGTTGACATGTCGGCTGCCGAGGCGTTTGTAAGAATTCAACGTCTGCTTTTCGCGAAGAGAGTTGTT
CTCGTTTTTTGTGGATTTTCGGACGATTCTGTTGTTGGGAAGGCGTTACAGAATGTGGGTGTGCTTGATGCTGAG
GGTGTGGAATTGTTTTCGACGTTCAATGACGCGATGGAATGGACTGAGAATGAATATCTTCATTCGTGGTTCCGT
TCGCATCCATTGGAACCACCTCGTACTTTACTTCCTGTGCCTGTTCGACGAGACCCTTCTTGGGATGTCCATCAT
ATCGCCGATCCGTTCGCTGTTTCTCCCCGGCGATCCCATATTTGGGATGTTGGAAATAAGACAATCGGCATTGAG
TTTGATTCTAACCTGTCAGAAGCGGATCTTACATCTAATCCTCTTAACACTTTATCGAGGGCATTTCCATGGGGT
TCCGATGATGCGCAAAAGTTCAAGGGGATTGTACGATATTTCTCGAGGCTCATCGTACCGACCGGACATATCCTT
TGGAAACAAGATGATAGTCCTGATGGACTCTATATTGTTGAATCTGGTGTATTGCGAGCGACGTATAAATTTAGG
AATCAAACGCAGAGCCTTGAAGAAACGATGGTATCGGGAACTATCGCTGGTGAATTATCGGCTTTGTCAAGTTTA
CCGAGGAACGCGACTTGTATAGTGGAACATCATGCTACGCTTTGGAAGATGAGTATGCAGGATCTTGATAAGCTA
CGGCGGGATGAACCGGCGTTGTCTGCATGGTTCATTCAGTTGATATTGAAAGCTGGAAAAACAGATTATGATATT
CTGTTATCAGCGGTTGCATCGTTTGGACTTGTGTTCGAGTTGGCTAGCTGCGATACTCCTCGCGCTTAG
Transcript >AgabiH97|051810
ATGCCTGAAGACAGATCATCTTCCAAGGCCTTTGCCAATTCTCGTCCTGACCACGCCTTCAATATTTCGCCCCTA
TCCGACTCCTCATTGCACCGAGCAGGGCTTCTGCGGCCAATGTCTTATAATCCTTCTAGTCCGCTCACTGGCCGC
TTCCTCCCAGGCTCCCTTCCTATAAGTCACAGGATCCCTCATCAGCACTCCCAACGTTCTATTCGACTCACAACA
ATGCAACTGTCTAATATGCCCGCGTCTTATCCTCAAAATATTGATTCCGTCCTTCTCGGCGGGATGCCTCTATCT
GCGCCATCTGATTCTCAGGGTCTGTGCCGTCAACATAATACTTCATATCATTCACTCCAACAAGACCCTCGCAAA
GATGATTCTCTTGCTACCCTTCCCTTATCTTCTGATGATAATCCCGCTCGTTCTCTCACACTATCACCTAATGAC
ACCGACATCCCCAACTCCAACTTAATTACCCCGACTGCAATTGCCCAATCACCTTCAGCATCAAACGTGACCTCC
GGTATGTCGGCCAGTGAGGCCAACTGGGAAGCAACGACTGAGCCTTATACCAGTCCTGCTCTTTCAAGTCCTCTT
CGTCAAGAATGCCGTGTCTCATCCCCTCCATCACCTTCGACCTCTGGTACAATTACACCTACTGGTCCTCCTAAC
GCACCTGACGAATATGAAAACGTATCTGGTCCGGCGGCCTGGTTTAAAGATCCGAACTCGCTATTACAAGTATCG
GAAAGGACATCATTATTACCACCCACCTCGCATCACGAACCCCACTCACAAAATGGGTATGGGACTCCCGAAATT
CGTCTCTCAACACCTGAAACAGAGAGCACTGATTTTCTACTTTTACACTACGACGGGATTCCAGCTTGGAAGAAG
GTCGTTAGAAAAACATTACATGATATACCCGTCAAGTCAAGAATGGTGTTGTCCGCAATCCCCGCCGTCTTACTT
GGCACTTTGATCAACATCCTTGACGGCATTAGCTACGGGATGATTATATTTCCCTCAACTGGAGTTTTTGCCGAC
CTGGGCTCGATGGGCGTTTCTTTGTTCTTCGTCTCAACCATAGCTGTCCAGTTCACGTATACGCTCGGAGGAAGC
TCATTTGCTGGAGCCAATGGTAGTATGATGATTGAAGTGGTGCCTTTTTTCCATATGATCGCAAACAGCATAGCC
TCGGAGATCGGAGAAGAACACCCGAGAGAAATCATTGCCACAACGTTGGTTGCATTCGCCGCCAGTTCTATCTTG
ACAGGATTATGCTTTTTCCTGTTGGGTTTATTGAAACTCGGGACGATTGTGGGGCTTTTCCCTCGTCACATCCTC
GTCGGATGTATCGGCGGGATTGGGGCATTTCTTATTCAAACAGGTTTGACTGTCAGCATGCATATGAGCGAAGAA
GATTTCACAATGTCTTTCGAAACTTTAAAAACCATGTTTTTGGACCATCACATGTTACTGTTATGGACAATTCCT
TTTGCCTTGGCAGTTCTACTTAGAATCATCACACACAAATTTCACCATCAGCTTGTATTTCCTCTTTATTTCCTT
GTTATACCCATTATTTTCTATATCGTTGTTGCCTCTGCTAGACTGGACTTAAATAAGCTTCGGACGGAAAACTGG
TTATTCGACGTAGGGAGTGCATCCGAGACGCCTTGGTATCATTACTTTTCTTATCTAGATCATCGCTTAATTCGA
TTTGGCGCATTGTGGTCTACGCTCCCGACTCAATTTGCTCTGCTATTTTTTAATATTTTGCACCCACCTCTGAAC
GTGCCTGCTTTAGCCGTTTCCCTTGATTGTGAATGTGACACGAATAAAGAGTTGATGGGGCATGGCTATTCTAAC
CTCTTATCTGGCCTTATCGGAAGCGTACCCAATTATCTTGTTTATGTGAACACACTTCTATTTTATCGAGTCGGA
GGCGATAACCGTGTTGCGGGGTTTTTGCTTGCTCTATCAACATGCGTCCTCCTTTTCATCGGGGTCGGCCCGATA
GCTTACATCCCTGTTATGGTTGTTGGAGCTTTGATTTTCGTGCTTGGCATTGATTTGGTGAAAGAAGCGTTATGG
GATACCCGACATCGAGTTAGCAGAGTGGAATATGTCACAATTATCGGCATAATGATAGTTATGACCGCTTGGGAC
TTCGTGACAGGCGTTTTGTTTGGTATCGTCGTTAGCTGTTTCTTCTTCGTCGTGCAAAATTCGCAGGTCGATTGT
ATTCGGTCAATTTATACTGGTGATACGGCTATGTCAGCTGTACGTCGATCAGGCTTGCAGCGCGCCTACATTCGA
GAAGTTGCGAAGCACACCACTATTCTCCGTCTTCAGGGTTTCCTTTTCTTTGGAACTATATCGCGCGTTGAAGAA
ACCATAAAGGGTCTCTTCGAAGCGCCTTCTTGGCAGAAAAATCCTATCCAATTCCTGGTTGTTGATATGGTTCAC
GTAGCGGGTGTTGACATGTCGGCTGCCGAGGCGTTTGTAAGAATTCAACGTCTGCTTTTCGCGAAGAGAGTTGTT
CTCGTTTTTTGTGGATTTTCGGACGATTCTGTTGTTGGGAAGGCGTTACAGAATGTGGGTGTGCTTGATGCTGAG
GGTGTGGAATTGTTTTCGACGTTCAATGACGCGATGGAATGGACTGAGAATGAATATCTTCATTCGTGGTTCCGT
TCGCATCCATTGGAACCACCTCGTACTTTACTTCCTGTGCCTGTTCGACGAGACCCTTCTTGGGATGTCCATCAT
ATCGCCGATCCGTTCGCTGTTTCTCCCCGGCGATCCCATATTTGGGATGTTGGAAATAAGACAATCGGCATTGAG
TTTGATTCTAACCTGTCAGAAGCGGATCTTACATCTAATCCTCTTAACACTTTATCGAGGGCATTTCCATGGGGT
TCCGATGATGCGCAAAAGTTCAAGGGGATTGTACGATATTTCTCGAGGCTCATCGTACCGACCGGACATATCCTT
TGGAAACAAGATGATAGTCCTGATGGACTCTATATTGTTGAATCTGGTGTATTGCGAGCGACGTATAAATTTAGG
AATCAAACGCAGAGCCTTGAAGAAACGATGGTATCGGGAACTATCGCTGGTGAATTATCGGCTTTGTCAAGTTTA
CCGAGGAACGCGACTTGTATAGTGGAACATCATGCTACGCTTTGGAAGATGAGTATGCAGGATCTTGATAAGCTA
CGGCGGGATGAACCGGCGTTGTCTGCATGGTTCATTCAGTTGATATTGAAAGCTGGAAAAACAGATTATGATATT
CTGTTATCAGCGGTTGCATCGTTTGGACTTGTGTTCGAGTTGGCTAGCTGCGATACTCCTCGCGCTTAG
Gene >AgabiH97|051810
ATGCCTGAAGACAGATCATCTTCCAAGGCCTTTGCCAATTCTCGTCCTGACCACGCCTTCGTAAGCGCTCCCTAT
TCCTTTAATAGTTTTGTGCTCAGGCCCCTGCGTGACATCAGAATATTTCGCCCCTATCCGACTCCTCATTGCACC
GAGCAGGGTACGTTAGACATCCTCATCAGCTTTCCTTGTGGAACTACTAGCTTACCTTTGCTTTTGGAGGCTTCT
GCGGCCAATGTCTTATAATCCTTCTAGTCCGCTCACTGGCCGCTTCCTCCCAGGCTCCCTTCCTATAAGTCACAG
GATCCCTCATCAGCACTCCCAACGTTCTATTCGACTCACAACAATGCAACTGTCTAATATGCCCGCGTCTTATCC
TCAAAATATTGATTCCGTCCTTCTCGGCGGGATGCCTCTATCTGCGCCATCTGATTCTCAGGGTCTGTGCCGTCA
ACATAATACTTCATATCATTGTCGGTCTTTTTTTAGTTTATGTCCAGCCAACACATCTGACCTTTTTAGCACTCC
AACAAGACCCTCGCAAAGATGATTCTCTTGCTACCCTTCCCTTATCTTCTGATGATAATCCCGCTCGTTCTCTCA
CACTATCACCTAATGACACCGACATCCCCAACTCCAACTTAATTACCCCGACTGCAATTGCCCAATCACCTTCAG
CATCAAACGTGACCTCCGGTGAGTATTTTTTGCGCAACTTTCTCTCTTTCTTCTTCTTAACCTCTTGTTCTTTTA
GGTATGTCGGCCAGTGAGGCCAACTGGGAAGCAACGGTAGGTTGCGGTGGTCCTGTTATCTGTTTCCGGGACGCT
CTTAAAGTTTGTTCATTAGACTGAGCCTTATACCAGTCCTGCTCTTTCAAGTCCTCTTCGTCAAGAATGCCGTGT
CTCATCCCCTCCATCACCTTCGACCTCTGGTACAATTACACCTACTGGTCCTCCTAACGCACCTGACGAATATGA
AAACGTATCTGGTCCGGCGGCCTGGTTTAAAGATCCGAACTCGCTATTACAAGTATCGGAAAGGACATCATTATT
ACCACCCACCTCGCATCACGAACCCCACTCACAAAATGGGTATGGGACTCCCGAAATTCGTCTCTCAACACCTGA
AACAGAGAGCACTGATTTTCTACTTTTACACTACGACGGGATTCCAGCTTGGAAGAAGGTCGTTAGAAAAACATT
ACATGATATACCCGTCAAGTCAAGAATGGTGTTGTCCGCAATCCCCGCCGTCTTACTTGGCACTTTGATCAACAT
CCTTGACGGCATTAGCTGTAAGTCACTTATGCTTGCCTCATCAAGTCTCAAGATGTTTCTAAGCTCTAACATTTT
AGACGGGATGATTATATTTCCCTCAACTGGAGTTTTTGCCGACCTGGGCTCGATGGGCGTTTCTTTGTTCTTCGT
CTCAACCATAGCTGTCCAGTTCACGTATACGCTCGGAGGAAGCTCATTTGCTGGAGCCAATGGTAGTATGATGAT
TGAAGTGGTGGTATGTTAATTGAATGTTTTTTTTGACGTTTGGTACAGCCTCGCTCACTGCCGTCCCAGCCTTTT
TTCCATATGATCGCAAACAGCATAGCCTCGGAGATCGGAGAAGAACACCCGAGAGAAATCATTGCCACAACGTTG
GTTGCATTCGCCGCCAGTTCTATCTTGACAGGATTATGCTTTTTCCTGTTGGGTTTATTGAAACTCGGGACGATT
GTGGGGCTTTTCCCTCGTCACATCCTCGTCGGGTAAGTCGTAATAGTTACTCCCTATTATTTTCACACTTTATCT
GAATTATACTATCCCAGATGTATCGGCGGGATTGGGGCATTTCTTATTCAAACAGGGTGCGTACCCGAAGGGCAC
AGCAGCTGATCATTTTCCTTATCGCGGTACTCACATGGCTGCATTTAGTTTGACTGTCAGCATGCATATGAGCGA
AGAAGATTTCACAATGTCTTTCGAAACTTTAAAAACCATGTTTTTGGACCATCACATGTTACTGTTATGGACAAT
TCCTTTTGCCTTGGCAGTTCTACTTAGAATCATCACACACAAATTTCACCATCAGCTTGTATTTCCTCTTTGTAA
GTGTTCATGCTCCGCGGACAATTCCTTTCTGACAAACCTTCAACTTGTTAGATTTCCTTGTTATACCCATTATTT
TCTATATCGTTGTTGCCTCTGCTAGACTGGACTTAAATAAGCTTCGGACGGAAAACTGGTTATTCGACGTAGGGA
GTGCATCCGAGACGCCTTGGTATCATTACTTTTCTTATCTAGGTCGGTACCTTTTTTAGGGACGCCAAGATATTT
TAGTCTAACTTTTTTTGACAGATCATCGCTTAATTCGATTTGGCGCATTGTGGTCTACGCTCCCGACTCAATTTG
CTCTGTGCGTTTGTCATACCCCTTTCATTGAGGTCGTATAACTGATGAGTTGCCCTTAAGGCTATTTTTTAATAT
TTTGCACCCACCTCTGAACGTGCCTGCTTTAGGTAAGTTCCGATATCAGTCTTATCTTTGATGCGCGCGTTGGTC
TGAAGTTAATGGTTTCTCTTTCCCGCATCAGCCGTTTCCCTTGATTGTGAATGTGACACGAATAAAGAGTTGATG
GGGCATGGCTATTCTAACCTCTTATCTGGCCTTATCGGAAGCGTGTAAGTTGTCAATTCGAAACGGTCTTTTCCC
TGACTCTGTGAATTTTTATTAGACCCAATTATCTTGTTTATGTGAACACACTTCTGTGAGTTCCGGCATTTTTTC
TTATCCACATGGGTCCCGGTTTCCCTGACTAGCAACGCTATTCTAGATTTTATCGAGTCGGAGGCGATAACCGTG
TTGCGGGGTTTTTGCTTGCTCTATCAACATGCGTCCTCCTTTTCATCGGGGTCGGCCCGATAGCTTACATCCGTG
AGTAATAGGAAAGAAAACATGTGCGTCGTGTTGACATTATCAACTGTATAGCTGTTATGGTTGTTGGAGCTTTGA
TTTTCGTGCTTGGCATTGATTTGGTGAAAGAAGCGTTATGGGATACCCGACATCGAGTTAGCAGGTACAGTTGTC
TTGCCTCATCTATTCTTTACCTTATCTGACATTTTCTGTCTTGTTTTTTTCCTTCCTTTTTCGTTTTTTGTTTTC
GCCGGTGATGCAGAGTGGAATATGTCACAATTATCGGCATAATGATAGTTATGACCGCTTGGGACTTCGTGACAG
GCGTTTTGTTTGGTATCGTCGTTAGCTGTAAGTACTCCTTGGATTTCGGCTTGTGGAAAGCTAAGCCGACGTGTT
TAGGTTTCTTCTTCGTCGTGCAAAATTCGCAGGTCGATTGTATTCGGTCAATTTATACTGGTGATACGGCTATGT
CAGCTGTACGTCGATCAGGCTTGCAGCGCGCCTACATTCGAGAAGTTGCGAAGCACACCACTATTCTCCGTCTTC
AGGGTTTGTATACATTGGACTTTTTGCGCTATTTCTTTTGTATTTACATTTTTGCTCCGCAGGTTTCCTTTTCTT
TGGAACTATATCGCGCGTTGAAGAAACCATAAAGGGTCTCTTCGAAGCGCCTTCTTGGCAGAAAAATCCTATCCA
ATTCCTGGTTGTTGATATGGTTCACGTAGCGGGTGTTGACATGTCGGCTGCCGAGGCGTTTGTAAGAATTCAACG
TCTGCTTTTCGCGAAGAGAGTTGTTCTCGTTTTTTGTGGATTTTCGGACGATTCTGTTGTTGGGAAGGCGTTACA
GAATGTGGGTGTGCTTGATGCTGAGGGTGTGGAATTGTTTTCGACGTTCAATGACGCGATGGAATGTGAGTGAAT
TGAATTTTTGTCAGTGATGGTGAACAGGTTTTTGAAGATTGATATAGGGACTGAGAATGAATATCTTCATTCGTG
GTTCCGTTCGCATCCATTGGAACCACCTCGTACTTTACTTCGTAAGTATAATTTTGGTATTGCATCGTGAATAGG
CTGACGAACTGTTATTAATATTTTTTATCGGACTTTCCGTTTTTGTTCAATAGCTGTGCCTGTTCGACGAGACCC
TTCTTGGGATGTCCATCATATCGCCGATCCGTTCGCTGTTTCTCCCCGGCGATCCCATATTTGGGATGTTGGAAA
TAAGACAATCGGCATTGGTGAGCTTGCGATTCCACAAGTTGGGTAATTTTGTACCCATGACTGACCATTTTTTGT
AGAGTTTGATTCTAACCTGTCAGAAGCGGATCTTACATCTAATCCTCTTAACACTTTATCGAGGGCATTTCCATG
GGGTTCCGATGATGCGCAAAAGTTCAAGGGGATTGTACGATATTTCTCGAGGCTCATCGTACCGACCGGACATAT
CCTTTGGAAACAAGATGATAGTCCTGATGGACTCTATATTGTTGAATCTGGTGTATTGCGAGCGACGTATAAATT
TAGGAATCAAACGCAGAGCCTTGAAGAAACGATGGTATCGGGAACTATCGCTGGTGAATTATCGGCTTTGTCAAG
TTTACCGAGGAACGCGACTTGTATAGTGGAACATCATGCTACGCTTTGGAAGATGAGTATGCAGGATCTTGATAA
GCTACGGCGGGATGAACCGGCGTTGTCTGCATGGTTCATTCAGTTGATATTGAAAGGTGAGGCTTTGCAATGTTC
GCTGCATGTGATATGTACTGACTTATCATCACTTTTTTTTCATATCAGCTGGAAAAACAGATTATGATATTCTGT
TATCAGCGGTTGCATGTAGGCAGTGATAAGTGTGTATACGCTGGTAACATGGAAATGCAGCGTTTGGACTTGTGT
TCGAGTTGGCTAGCTGCGATACTCCTCGCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail