© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|051680 |
| Gene name | |
| Location | scaffold_2:3274878..3275527 |
| Strand | - |
| Gene length (bp) | 649 |
| Transcript length (bp) | 411 |
| Coding sequence length (bp) | 411 |
| Protein length (aa) | 137 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P86242|PAPI_STRMB | Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 | 37 | 136 | 4.0E-08 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.0644 | 0.0363 | 0.9596 | 0.0449 | 0.0638 | 0.0092 | 0.0946 | 0.1216 | 0.0737 | 0.0064 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 21 | 0.999719 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 7545.59 | 0.00 | 15909.50 |
| Initials | Initials knots | 121.60 | 65.66 | 177.55 |
| Pileal_Stipeal_center | Stage I stipe center | 4074.10 | 1996.20 | 6152.00 |
| Pileal_Stipeal_shell | Stage I stipe shell | 3868.24 | 1799.32 | 5937.16 |
| DIF_stipe_center | Stage II stipe center | 6227.02 | 2660.22 | 9793.82 |
| DIF_stipe_shell | Stage II stipe shell | 3871.07 | 1815.89 | 5926.25 |
| DIF_stipe_skin | Stage II stipe skin | 1518.30 | 856.62 | 2179.98 |
| DIF_cap_skin | Stage II cap skin | 3751.91 | 1827.01 | 5676.80 |
| DIF_cap_tissue | Stage II cap tissue | 7651.38 | 3040.68 | 12262.10 |
| DIF_gill_tissue | Stage II gill tissue | 9749.79 | 3495.12 | 16004.50 |
| YFB_stipe_center | Young fruiting body stipe center | 6730.97 | 2776.64 | 10685.30 |
| YFB_stipe_shell | Young fruiting body stipe shell | 4525.81 | 2119.27 | 6932.34 |
| YFB_stipe_skin | Young fruiting body stipe skin | 1089.06 | 638.90 | 1539.21 |
| YFB_cap_skin | Young fruiting body cap skin | 955.65 | 565.58 | 1345.72 |
| YFB_cap_tissue | Young fruiting body cap tissue | 7545.58 | 3068.06 | 12023.10 |
| YFB_gill_tissue | Young fruiting body gill tissue | 2377.65 | 854.10 | 3901.20 |
| YFB_veil | Young fruiting body veil | 3251.60 | 1273.59 | 5229.61 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.780298 | no |
| Casing | YFB_stipe_center | 0.909397 | no |
| Casing | YFB_stipe_shell | 0.467485 | no |
| Casing | YFB_stipe_skin | 0.007092 | yes |
| Casing | YFB_cap_skin | 0.004928 | yes |
| Casing | YFB_cap_tissue | 0.999950 | no |
| Casing | YFB_gill_tissue | 0.111957 | no |
| Casing | YFB_veil | 0.247368 | no |
| Casing | Initials | 0.000613 | yes |
| Casing | Pileal_Stipeal_center | 0.375672 | no |
| Casing | Pileal_Stipeal_shell | 0.343969 | no |
| Casing | DIF_stipe_center | 0.826513 | no |
| Casing | DIF_stipe_shell | 0.345468 | no |
| Casing | DIF_stipe_skin | 0.026215 | yes |
| Casing | DIF_cap_skin | 0.320737 | no |
| Casing | DIF_cap_tissue | 0.988934 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.488298 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.058147 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.678405 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.006387 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.372489 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.873037 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.006742 | yes |
| YFB_stipe_center | YFB_veil | 0.076262 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.217972 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.116118 | no |
| YFB_stipe_shell | YFB_veil | 0.503635 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.765426 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.042041 | yes |
| YFB_stipe_skin | YFB_veil | 0.002525 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.015529 | yes |
| YFB_cap_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.001140 | yes |
| YFB_cap_tissue | YFB_veil | 0.029890 | yes |
| YFB_gill_tissue | YFB_veil | 0.584875 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.026215 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.218198 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.865539 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.114583 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.203521 | no |
| Pileal_Stipeal_center | YFB_veil | 0.680906 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.940475 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.310583 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.943748 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_skin | 0.895608 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.097776 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.018896 | yes |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.165935 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.785937 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.081406 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.270253 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.775117 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.243095 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.998914 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.002951 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.965027 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.071041 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.352090 | no |
| DIF_stipe_center | YFB_stipe_center | 0.918333 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.498845 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.757180 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.011659 | yes |
| DIF_stipe_center | YFB_veil | 0.110551 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.245982 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.191686 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.726970 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.018896 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.168405 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.787195 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.084184 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.272049 | no |
| DIF_stipe_shell | YFB_veil | 0.774139 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.002084 | yes |
| DIF_stipe_shell | DIF_cap_skin | 0.964889 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.072862 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.309920 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.109462 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.277589 | no |
| DIF_stipe_skin | YFB_veil | 0.037818 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.002084 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.014374 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.133853 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.724739 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_tissue | 0.062995 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.303269 | no |
| DIF_cap_skin | YFB_veil | 0.818950 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.055979 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.689868 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.853079 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.188282 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.985705 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.001140 | yes |
| DIF_cap_tissue | YFB_veil | 0.026955 | yes |
| Orthofinder run ID | 1 |
| Orthogroup | 375 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|051680 MRLSSLISVLSLSGALSVVQGISVLPRANPAYVGTMFLFDPGQGACGFTNTSTQIVASVSRQIFTTYPNATKNPN KNPICKHQVSIFYGGKTLAAPIVDFFTDPNAQLNVGLSLPGFEQFASRDDGIVEGVRWTIV* |
| Coding | >AgabiH97|051680 ATGCGACTTTCATCTCTCATATCCGTGCTCTCGCTCTCAGGAGCATTATCTGTTGTTCAAGGAATAAGCGTACTA CCTCGTGCAAATCCGGCATATGTTGGCACCATGTTCCTTTTTGATCCTGGACAAGGTGCATGCGGGTTTACCAAC ACTTCCACTCAGATAGTGGCATCCGTATCGCGACAAATCTTCACGACATACCCAAATGCGACTAAAAATCCCAAC AAAAATCCCATCTGCAAGCACCAAGTTTCCATCTTCTATGGTGGAAAGACGCTCGCTGCACCCATTGTCGACTTT TTCACTGATCCGAATGCGCAACTCAATGTTGGATTATCCTTACCTGGCTTTGAACAGTTTGCTAGTAGGGACGAT GGTATCGTTGAAGGCGTTCGCTGGACCATTGTTTGA |
| Transcript | >AgabiH97|051680 ATGCGACTTTCATCTCTCATATCCGTGCTCTCGCTCTCAGGAGCATTATCTGTTGTTCAAGGAATAAGCGTACTA CCTCGTGCAAATCCGGCATATGTTGGCACCATGTTCCTTTTTGATCCTGGACAAGGTGCATGCGGGTTTACCAAC ACTTCCACTCAGATAGTGGCATCCGTATCGCGACAAATCTTCACGACATACCCAAATGCGACTAAAAATCCCAAC AAAAATCCCATCTGCAAGCACCAAGTTTCCATCTTCTATGGTGGAAAGACGCTCGCTGCACCCATTGTCGACTTT TTCACTGATCCGAATGCGCAACTCAATGTTGGATTATCCTTACCTGGCTTTGAACAGTTTGCTAGTAGGGACGAT GGTATCGTTGAAGGCGTTCGCTGGACCATTGTTTGA |
| Gene | >AgabiH97|051680 ATGCGACTTTCATCTCTCATATCCGTGCTCTCGCTCTCAGGAGCATTATCTGTTGTTCAAGGAATAAGCGTACTA CCTCGTGCAAATCCGGCATATGTTGGCACCAGTCTGTATCTGTTTTTTACTTATCTCAGTCGATGAGTTCTGACT TGATTAACGATTTGATAGTGTTCCTTTTTGATCCTGGACAAGGTGCATGCGGGTTTACCAACACTTCCACTCAGA TAGTGGCATCCGTATCGCGACAAATCTTCACGACATACCCGTAAGTTTTCAATTTAAACTTCGATATTCAAGTTC TTGGGTACTCATGCCGAAATCCAAAGAAATGCGACTAAAAATCCCAACAAGTATGTAACCAACCCGTTCTACTTT GAAAAATACCATTTAAGCAATATCATAGAAATCCCATCTGCAAGCACCAAGTTTCCATCTTCTGTGGGTCGACAA TTTTCCGCCCACATTAAGCTTTTGCTTCGATATTTAACACATTTTTTTAGATGGTGGAAAGACGCTCGCTGCACC CATTGTCGACTTTTTCACTGATCCGAATGCGCAACTCAATGTTGGATTATCCTTACCTGGCTTTGAACAGTTTGC TAGTAGGGACGATGGTATCGTTGAAGGCGTTCGCTGGACCATTGTTTGA |