Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051600
Gene name
Locationscaffold_2:3263391..3264218
Strand+
Gene length (bp)827
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.4E-06 86 148

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 214 236 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051600
MRLSSSQTLFLTLVYYLSFTWAQTLIPPSSLPDVSSSGSMTSGSSPARGSATLTSSSSSSSAISGSGSGSASVSA
TRTSSAQFPSLSGISACVNTCLATSVADVNCDDLVGVDCWCPNARFPLTYFNCVANGCTSELSTAENLVQQFCRQ
SNATLSATSVSFPSFPMSSSQSVSATMTTQSSGTSSGASSDNDSPPAATSSSAASSIGLNTDAYTTMGSFFVLMM
TAVACGFVNGVEL*
Coding >AgabiH97|051600
ATGCGTCTCTCTTCCTCGCAGACCCTCTTTCTGACTCTGGTTTATTATCTATCCTTCACATGGGCACAAACTCTG
ATTCCACCATCAAGTTTACCTGACGTTTCGAGTTCCGGATCTATGACATCGGGCTCTTCTCCGGCTCGTGGTAGT
GCCACGCTAACCAGTAGTAGTAGCAGTTCAAGCGCTATCTCTGGAAGTGGAAGTGGAAGTGCGAGCGTATCTGCG
ACGAGGACGAGTTCTGCTCAGTTTCCAAGTTTGAGTGGTATTTCTGCTTGCGTGAACACTTGCTTGGCGACTTCA
GTTGCGGATGTCAACTGTGATGATCTCGTCGGTGTAGATTGCTGGTGTCCTAATGCCAGATTCCCATTAACGTAT
TTCAATTGTGTTGCCAACGGCTGTACTTCCGAACTTTCCACAGCAGAAAACCTGGTTCAACAATTCTGTAGGCAG
TCAAACGCTACATTATCAGCCACATCCGTATCATTCCCATCTTTTCCAATGTCGAGCTCGCAAAGTGTTTCTGCC
ACGATGACTACTCAGTCATCAGGAACTTCTTCGGGAGCTTCTTCGGATAACGACAGTCCTCCTGCCGCTACTAGT
TCCAGTGCCGCTTCTTCAATTGGATTGAATACCGATGCATATACCACAATGGGATCCTTCTTTGTGTTGATGATG
ACGGCTGTTGCATGTGGATTTGTGAATGGCGTGGAGTTGTAG
Transcript >AgabiH97|051600
ATGCGTCTCTCTTCCTCGCAGACCCTCTTTCTGACTCTGGTTTATTATCTATCCTTCACATGGGCACAAACTCTG
ATTCCACCATCAAGTTTACCTGACGTTTCGAGTTCCGGATCTATGACATCGGGCTCTTCTCCGGCTCGTGGTAGT
GCCACGCTAACCAGTAGTAGTAGCAGTTCAAGCGCTATCTCTGGAAGTGGAAGTGGAAGTGCGAGCGTATCTGCG
ACGAGGACGAGTTCTGCTCAGTTTCCAAGTTTGAGTGGTATTTCTGCTTGCGTGAACACTTGCTTGGCGACTTCA
GTTGCGGATGTCAACTGTGATGATCTCGTCGGTGTAGATTGCTGGTGTCCTAATGCCAGATTCCCATTAACGTAT
TTCAATTGTGTTGCCAACGGCTGTACTTCCGAACTTTCCACAGCAGAAAACCTGGTTCAACAATTCTGTAGGCAG
TCAAACGCTACATTATCAGCCACATCCGTATCATTCCCATCTTTTCCAATGTCGAGCTCGCAAAGTGTTTCTGCC
ACGATGACTACTCAGTCATCAGGAACTTCTTCGGGAGCTTCTTCGGATAACGACAGTCCTCCTGCCGCTACTAGT
TCCAGTGCCGCTTCTTCAATTGGATTGAATACCGATGCATATACCACAATGGGATCCTTCTTTGTGTTGATGATG
ACGGCTGTTGCATGTGGATTTGTGAATGGCGTGGAGTTGTAG
Gene >AgabiH97|051600
ATGCGTCTCTCTTCCTCGCAGACCCTCTTTCTGACTCTGGTTTATTATCTATCCTTCACATGGGCACAAACTCTG
ATTCCACCATCAAGTTTACCTGACGTTTCGAGTTCCGGATCTATGACATCGGGCTCTTCTCCGGCTCGTGGTAGT
GCCACGCTAACCAGTAGTAGTAGCAGTTCAAGCGCTATCTCTGGAAGTGGAAGTGGAAGTGCGAGCGTATCTGCG
ACGAGGACGAGTTCTGCTCAGTTTCCAAGTTTGAGTGGTATTTCTGCTTGCGGTGCGTCCTGATACAGTTGACCG
CCTTTTATTCTATATAAAAACTCCGCTAGTGAACACTTGCTTGGCGACTTCAGTTGCGGATGTCAACTGTGATGA
TCTCGTCGGTGTAGATTGCTGGTGTCCTAAGTAAAATCCCCTCCTTGAAACCCCTCTTATTATCTTTACTAACAA
AAGACAAATCTAGTGCCAGATTCCCATTAACGTATTTCAATTGTGTTGCCAACGGCTGTACTTCCGAACTTTCCA
CAGCAGAAAACCTGGTTCAACAATTCTGTAGGCAGTCAAACGCTACATTATCAGCCACATCCGTATCATTCCCAT
CTTTTCCAATGTCGAGCTCGCAAAGTGTTTCTGCCACGATGACTACTCAGTCATCAGGAACTTCTTCGGGAGCTT
CTTCGGATAACGACAGTCCTCCTGCCGCTACTAGTTCCAGTGCCGCTTCTTCAATTGGATTGAATACCGATGCAT
ATACCACAATGGGATCCTTCTTTGTGTTGATGATGACGGCTGTTGCATGTGGATTTGTGAATGGCGTGGAGTTGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail