Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051570
Gene name
Locationscaffold_2:3256532..3257346
Strand-
Gene length (bp)814
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 9 156 4.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051570
MIFAISFALASALVTSAADFNVTVGANNQLVFDPTSVTVQNGDTVHFEFVSKNHSATQSTFANPCARVDGGVDSG
FLNVADNVPSVWSFTVNDASSPFWFHCAQTSPANHCQTGMVFAINPTAEKSFDAFQASAKSSANGTTPGDISAES
SPGTTPPANATDGASSGTPSSSGSDTSVPSGTGFSTSNATTTPSSGASSPDSTQNPNGAIFTRGSSSVGVATVAS
LIVAFVF*
Coding >AgabiH97|051570
ATGATCTTTGCTATTTCTTTCGCTCTCGCTTCTGCGCTCGTTACCTCTGCAGCTGATTTCAATGTTACTGTGGGA
GCCAACAACCAGCTGGTCTTCGACCCAACTTCGGTTACAGTCCAAAACGGTGACACTGTTCACTTCGAATTCGTT
TCAAAAAATCACTCTGCCACTCAATCTACTTTCGCTAATCCATGTGCCCGAGTTGATGGTGGTGTTGATTCTGGC
TTTCTTAATGTCGCTGACAACGTCCCCTCGGTGTGGAGCTTCACGGTCAATGATGCAAGCTCACCCTTCTGGTTC
CACTGTGCGCAAACGAGTCCCGCAAACCATTGTCAAACGGGCATGGTCTTTGCTATAAATCCCACTGCTGAAAAG
TCATTTGACGCCTTCCAAGCATCTGCTAAGAGTAGTGCCAACGGTACCACACCGGGAGATATATCTGCAGAATCA
TCTCCAGGGACGACACCTCCCGCTAATGCAACTGACGGGGCAAGTTCGGGGACACCATCTTCCAGTGGATCGGAT
ACTAGCGTTCCATCTGGTACTGGTTTCTCGACATCAAACGCCACTACCACTCCAAGCAGTGGTGCATCATCTCCT
GATTCGACCCAGAACCCCAATGGTGCGATTTTCACCCGGGGCTCGAGCTCGGTTGGCGTCGCTACCGTTGCTAGC
TTGATTGTGGCCTTCGTATTTTAG
Transcript >AgabiH97|051570
ATGATCTTTGCTATTTCTTTCGCTCTCGCTTCTGCGCTCGTTACCTCTGCAGCTGATTTCAATGTTACTGTGGGA
GCCAACAACCAGCTGGTCTTCGACCCAACTTCGGTTACAGTCCAAAACGGTGACACTGTTCACTTCGAATTCGTT
TCAAAAAATCACTCTGCCACTCAATCTACTTTCGCTAATCCATGTGCCCGAGTTGATGGTGGTGTTGATTCTGGC
TTTCTTAATGTCGCTGACAACGTCCCCTCGGTGTGGAGCTTCACGGTCAATGATGCAAGCTCACCCTTCTGGTTC
CACTGTGCGCAAACGAGTCCCGCAAACCATTGTCAAACGGGCATGGTCTTTGCTATAAATCCCACTGCTGAAAAG
TCATTTGACGCCTTCCAAGCATCTGCTAAGAGTAGTGCCAACGGTACCACACCGGGAGATATATCTGCAGAATCA
TCTCCAGGGACGACACCTCCCGCTAATGCAACTGACGGGGCAAGTTCGGGGACACCATCTTCCAGTGGATCGGAT
ACTAGCGTTCCATCTGGTACTGGTTTCTCGACATCAAACGCCACTACCACTCCAAGCAGTGGTGCATCATCTCCT
GATTCGACCCAGAACCCCAATGGTGCGATTTTCACCCGGGGCTCGAGCTCGGTTGGCGTCGCTACCGTTGCTAGC
TTGATTGTGGCCTTCGTATTTTAG
Gene >AgabiH97|051570
ATGATCTTTGCTATTTCTTTCGCTCTCGCTTCTGCGCTCGTTACCTCTGCAGCTGATTTCAATGTTACTGTGGGA
GCCAACAACCAGCTGGTCTTCGACCCAACTTCGGTTACAGTCCAAAACGGTGACACTGTTCACTTCGAATTGTAA
AGCAGTTTCCACTTGATATCGAATTCTTCTTCACTAAAAATGTAATTTATACAGCGTTTCAAAAAATCACTCTGC
CACTCAATCTACTTTCGCTAATCCATGTGCCCGAGTTGATGGTGGTGTTGATTCTGGCTTTCTTAATGTCGCTGA
CAACGTCCCCTCGGTGTGGAGCTTCACGGTCAATGATGCAAGCTCACCCTTCTGGTTCCACTGTGCGCAAACGAG
TCCCGCAAACCATTGTCAAACGGGCATGGTCTTTGCTATAAATCCCACTGCTGAAAAGTCATTTGACGCCTTCCA
AGTAAGTTCATCCTTCTTTACAAAGGGAACGCTTCCTGAGGGTTTTTATTTTATCAAGGCATCTGCTAAGAGTAG
TGCCAACGGTACCACACCGGGAGATATATCTGCAGAATCATCTCCAGGGACGACACCTCCCGCTAATGCAACTGA
CGGGGCAAGTTCGGGGACACCATCTTCCAGTGGATCGGATACTAGCGTTCCATCTGGTACTGGTTTCTCGACATC
AAACGCCACTACCACTCCAAGCAGTGGTGCATCATCTCCTGATTCGACCCAGAACCCCAATGGTGCGATTTTCAC
CCGGGGCTCGAGCTCGGTTGGCGTCGCTACCGTTGCTAGCTTGATTGTGGCCTTCGTATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail