Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051370
Gene name
Locationscaffold_2:3208685..3210860
Strand+
Gene length (bp)2175
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 7.7E-29 22 352

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 177 515 1.0E-06
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 185 359 1.0E-05

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.6125 0.4089 0.0968 0.0925 0.332 0.0304 0.2512 0.2623 0.2095 0.8607

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup44
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|020370
Agaricus bisporus var bisporus H39 AgabiH39|022990
Agaricus bisporus var bisporus H39 AgabiH39|051590
Agaricus bisporus var bisporus H39 AgabiH39|109980
Agaricus bisporus var bisporus H39 AgabiH39|271800
Agaricus bisporus var bisporus H97 AgabiH97|020370
Agaricus bisporus var bisporus H97 AgabiH97|022990
Agaricus bisporus var bisporus H97 AgabiH97|051370 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|051590
Agaricus bisporus var bisporus H97 AgabiH97|109980
Rhodonia placenta FPRL280 RhoplFPRL280|583_3
Rhodonia placenta FPRL280 RhoplFPRL280|465_2
Rhodonia placenta FPRL280 RhoplFPRL280|465_1
Rhodonia placenta FPRL280 RhoplFPRL280|210_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_1
Rhodonia placenta FPRL280 RhoplFPRL280|150_1
Rhodonia placenta FPRL280 RhoplFPRL280|117_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_4
Rhodonia placenta FPRL280 RhoplFPRL280|86_1
Rhodonia placenta FPRL280 RhoplFPRL280|168_2
Rhodonia placenta FPRL280 RhoplFPRL280|93_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051370
MRLPPLDECPSISEALDFHRENNPQEPLYVFSVDSATAEPTSVSFETFGRACDRVAQFVRPGRLGNESDGTVVAL
LLVTDVLLYQAMFVGIMKSGYVPFPMSQRLTPQAIIHLLTKASCHHLMVTSAMLPMKLLDTIKEELETHHPNYEL
NVVEMPSPSYIYPDHWGITTSSTSYPVPPQQSSPDSIAFYFHSSGSTGLSKLVPLTNRVTCSWATLTLPPVEDFQ
VPSHRRYATMALLPAHALAFLGNTIFGIYHGFTLGLYPPTGSSLSASPIVPTPENFLEHAKRTRCAGILTAPIFV
KAWARSKSDVKELAKFRHIAFAGGPLSTEIGDALVAAGVNLQSMYGATEFGNPMKFSPRRGREKDWEWYEFCDSG
SHEFIDQENGTYEYHIMSNGLHQPSVINRPDGKGYATSDLFIKHPTNDKLWKIIGRLDDVVVLSMGTNIVPGPIE
AIMNNSPFIHGVVVFGRGHDRAGILVEPCSYQQFESPETAQKFRDLLWALVERVNSAVPLYSRILNEMILFTCQD
KPLPRTLKGTVAKKLALKLYEEEIKRVYKDISSSDNNIRVSLEFWGSPGLKNIL*
Coding >AgabiH97|051370
ATGCGTCTCCCTCCGCTTGACGAATGTCCCAGTATTTCTGAAGCCCTGGACTTCCATCGAGAAAACAATCCTCAG
GAGCCGCTTTATGTTTTTAGCGTCGATTCAGCGACTGCAGAACCCACCAGCGTGTCGTTTGAGACATTTGGTCGT
GCCTGCGACCGCGTGGCACAATTCGTCCGACCTGGACGCCTCGGGAACGAGTCCGACGGTACTGTCGTCGCACTC
CTGCTTGTCACCGATGTCCTCCTTTATCAAGCCATGTTCGTTGGAATCATGAAGTCTGGCTATGTGCCATTTCCC
ATGTCACAGCGCCTCACTCCTCAAGCTATCATTCACTTACTGACAAAAGCATCGTGCCATCATCTAATGGTAACT
TCCGCGATGCTTCCTATGAAATTGTTAGACACAATTAAGGAAGAACTCGAGACCCATCATCCGAATTACGAGCTA
AACGTCGTGGAAATGCCCTCCCCGTCCTATATCTACCCAGATCATTGGGGAATCACAACAAGCAGCACTTCTTAT
CCCGTTCCACCGCAGCAATCATCTCCTGACAGTATCGCTTTCTACTTTCATTCTTCTGGAAGTACAGGTTTATCC
AAGCTCGTTCCACTCACAAATCGAGTTACTTGTAGTTGGGCTACACTGACTCTTCCACCAGTCGAAGACTTTCAG
GTTCCTTCTCATCGCCGATACGCTACGATGGCTCTCCTGCCAGCGCATGCTCTCGCGTTCCTCGGAAATACTATA
TTCGGCATTTACCATGGCTTTACCTTGGGTCTCTACCCACCAACCGGATCGTCCTTGAGCGCTTCACCCATAGTC
CCCACCCCCGAGAATTTCTTGGAACATGCGAAAAGAACTCGGTGCGCTGGCATACTTACCGCCCCAATTTTCGTC
AAGGCTTGGGCGCGGTCAAAGTCGGATGTTAAAGAATTGGCAAAATTCAGACATATCGCATTCGCTGGAGGTCCA
TTATCGACAGAAATAGGGGATGCTCTCGTTGCAGCCGGAGTTAACTTACAGTCTATGTATGGAGCAACAGAATTT
GGCAATCCGATGAAATTCTCTCCTCGACGAGGTAGAGAGAAAGACTGGGAGTGGTATGAATTCTGCGATTCAGGT
TCTCATGAGTTCATTGATCAGGAAAATGGTACATATGAATATCATATCATGTCAAATGGACTTCACCAACCATCT
GTGATCAATCGGCCGGACGGCAAGGGCTACGCGACTTCAGACCTGTTTATAAAGCACCCTACAAACGACAAGCTT
TGGAAAATTATTGGTCGGCTAGATGACGTGGTGGTACTGTCTATGGGAACAAACATTGTCCCAGGACCTATTGAA
GCCATCATGAACAATAGTCCGTTCATCCACGGTGTCGTCGTCTTCGGCCGAGGCCATGACAGGGCTGGGATCCTG
GTCGAACCATGCTCGTACCAACAATTTGAATCTCCCGAGACTGCGCAAAAATTCCGTGATTTGCTATGGGCACTG
GTTGAGAGGGTGAACAGCGCTGTACCGCTGTATAGCCGAATATTGAACGAGATGATCCTTTTCACCTGTCAAGAT
AAACCTTTGCCTCGTACTCTGAAAGGAACCGTTGCGAAGAAGTTGGCACTAAAATTGTATGAAGAGGAAATTAAA
AGAGTGTACAAAGATATTTCTAGTTCTGACAACAACATCAGAGTGTCCCTCGAGTTTTGGGGATCGCCAGGGCTG
AAAAATATCCTATAA
Transcript >AgabiH97|051370
ATGCGTCTCCCTCCGCTTGACGAATGTCCCAGTATTTCTGAAGCCCTGGACTTCCATCGAGAAAACAATCCTCAG
GAGCCGCTTTATGTTTTTAGCGTCGATTCAGCGACTGCAGAACCCACCAGCGTGTCGTTTGAGACATTTGGTCGT
GCCTGCGACCGCGTGGCACAATTCGTCCGACCTGGACGCCTCGGGAACGAGTCCGACGGTACTGTCGTCGCACTC
CTGCTTGTCACCGATGTCCTCCTTTATCAAGCCATGTTCGTTGGAATCATGAAGTCTGGCTATGTGCCATTTCCC
ATGTCACAGCGCCTCACTCCTCAAGCTATCATTCACTTACTGACAAAAGCATCGTGCCATCATCTAATGGTAACT
TCCGCGATGCTTCCTATGAAATTGTTAGACACAATTAAGGAAGAACTCGAGACCCATCATCCGAATTACGAGCTA
AACGTCGTGGAAATGCCCTCCCCGTCCTATATCTACCCAGATCATTGGGGAATCACAACAAGCAGCACTTCTTAT
CCCGTTCCACCGCAGCAATCATCTCCTGACAGTATCGCTTTCTACTTTCATTCTTCTGGAAGTACAGGTTTATCC
AAGCTCGTTCCACTCACAAATCGAGTTACTTGTAGTTGGGCTACACTGACTCTTCCACCAGTCGAAGACTTTCAG
GTTCCTTCTCATCGCCGATACGCTACGATGGCTCTCCTGCCAGCGCATGCTCTCGCGTTCCTCGGAAATACTATA
TTCGGCATTTACCATGGCTTTACCTTGGGTCTCTACCCACCAACCGGATCGTCCTTGAGCGCTTCACCCATAGTC
CCCACCCCCGAGAATTTCTTGGAACATGCGAAAAGAACTCGGTGCGCTGGCATACTTACCGCCCCAATTTTCGTC
AAGGCTTGGGCGCGGTCAAAGTCGGATGTTAAAGAATTGGCAAAATTCAGACATATCGCATTCGCTGGAGGTCCA
TTATCGACAGAAATAGGGGATGCTCTCGTTGCAGCCGGAGTTAACTTACAGTCTATGTATGGAGCAACAGAATTT
GGCAATCCGATGAAATTCTCTCCTCGACGAGGTAGAGAGAAAGACTGGGAGTGGTATGAATTCTGCGATTCAGGT
TCTCATGAGTTCATTGATCAGGAAAATGGTACATATGAATATCATATCATGTCAAATGGACTTCACCAACCATCT
GTGATCAATCGGCCGGACGGCAAGGGCTACGCGACTTCAGACCTGTTTATAAAGCACCCTACAAACGACAAGCTT
TGGAAAATTATTGGTCGGCTAGATGACGTGGTGGTACTGTCTATGGGAACAAACATTGTCCCAGGACCTATTGAA
GCCATCATGAACAATAGTCCGTTCATCCACGGTGTCGTCGTCTTCGGCCGAGGCCATGACAGGGCTGGGATCCTG
GTCGAACCATGCTCGTACCAACAATTTGAATCTCCCGAGACTGCGCAAAAATTCCGTGATTTGCTATGGGCACTG
GTTGAGAGGGTGAACAGCGCTGTACCGCTGTATAGCCGAATATTGAACGAGATGATCCTTTTCACCTGTCAAGAT
AAACCTTTGCCTCGTACTCTGAAAGGAACCGTTGCGAAGAAGTTGGCACTAAAATTGTATGAAGAGGAAATTAAA
AGAGTGTACAAAGATATTTCTAGTTCTGACAACAACATCAGAGTGTCCCTCGAGTTTTGGGGATCGCCAGGGCTG
AAAAATATCCTATAA
Gene >AgabiH97|051370
ATGCGTCTCCCTCCGCTTGACGAATGTCCCAGTATTTCTGAAGCCCTGGACTTCCATCGAGAAAACAATCCTCAG
GAGCCGCTTTATGTTTTTAGCGTCGATTCAGCGACTGCAGAACCCACCAGCGTGTCGTTTGAGACATTTGGTCGT
GCCTGCGACCGCGTGGCACAATTCGTCCGACCTGGACGCCTCGGGAACGAGTCCGACGGTACTGTCGTCGCACTC
CTGCTTGTCACCGATGTCCTCCTTTATCAAGCCATGTTCGTTGGAATCATGAAGTCTGGCTATGTGGTGAGAGTA
CTGTATAATACAAACCTCGTCGCATGCTCTCAACATTCTCCCTAGCCATTTCCCATGTCACAGCGCCTCACTCCT
CAAGCTATCATTCACTTACTGACAAAAGCATCGTGCCATCATCTAATGGTAACTTCCGCGATGCTTCCTATGAAA
TTGTTAGACACAATTAAGGAAGAACTCGAGACCCATCATCCGAATTACGAGCTAAACGTCGTGGAAATGCCCTCC
CCGTCCTATATCTACCCAGATCATTGGGGAATCACAACAAGCAGCACTTCTTATCCCGTTCCACCGCAGCAATCA
TCTCCTGACAGTATCGCTTTCTACTTTCATTCTTCTGGAAGTACAGGTTTATCCAAGCTCGTTCCACTCACAAAT
CGAGTTACTTGTAGTTGGGCTACACTGAGTAAGCCTATTGCTAGTTAGATCTTCCTCCCCAAGTCTAATAACACC
CTTGTGTAGCTCTTCCACCAGTCGAAGACTTTCAGGTTCCTTCTCATCGCCGATACGCTACGATGGCTCTCCTGC
CAGCGCATGCTCTCGCGTTCCTCGGAAATACTATATTCGGCATTTACCATGGCTTTACCTTGGGTCTCTACCCAC
CAACCGGATCGTCCTTGAGCGCTTCACCCATAGTCCCCACCCCCGAGAATTTCTTGGAACATGCGAAAAGAACTC
GGTGCGCTGGCATACTTACCGCCCCAATTTTCGTCAAGGCTTGGGCGCGGTCAAAGTCGGATGTTAAAGAATTGG
CAAAATTCAGACATATCGTACGTTCGTCGACGCTCTCCTTGTTCAAGGAGCTCATCGAATCGCATTTAGGCATTC
GCTGGAGGTCCATTATCGACAGAAATAGGGGATGCTCTCGTTGCAGCCGGAGTTAACTTACAGTCTATGTATGGA
GCAACAGAATTTGGCAATCCGATGAAATTCTCTCCTCGACGAGGTAGAGAGAAAGACTGGGAGTGGTATGAATTC
TGCGATTCAGGTTCTCATGAGTTCATTGATCAGGAAAATGGTACATATGAATATCATATCATGGTAAGTTCGTCC
GTTTCTATCAACAAACATATCGGGTTATAATTCATGACACACGCGTTAGTCAAATGGACTTCACCAACCATCTGT
GATCAATCGGCCGGACGGCAAGGGCTACGCGACTTCAGACCTGTTTATAAAGCACCCTACAAACGACAAGCTTTG
GAAAATGTTAGCAATTTATCTTCTATAGAAGTTTCTAACTAATTTGTATCAAGTATTGGTCGGCTAGATGACGTG
GTGGTACTGTCTATGGGAACAAACATTGTCCCAGGACCTATTGAAGCCATCATGAACAATAGTCCGTTGTGAGTA
CTGAACATAACGTAGTCCTAACTCAAATTCTAACGGCATAAAGCATCCACGGTGTCGTCGTCTTCGGCCGAGGCC
ATGACAGGGCTGGGATCCTGGTCGAACCATGCTCGTACCAACAATTTGAATCTCCCGAGACTGCGCAAAAATTCC
GTGATTTGCTATGGTGAGTGACACAGTATCTGAATCACCATTCAAAACGTTTTTAATAGCATTTACGAGTAGGGC
ACTGGTTGAGAGGGTGAACAGCGCTGTACCGCTGTATAGCCGAATATTGAACGAGATGATCCTTTTCACCTGTCA
AGATAAACCTTTGCCTCGTACTCTGAAAGGAACCGTTGCGAAGAAGTTGGCACTAAAATTGTATGAAGAGGAAAT
TAAAAGAGTGTACGTTCCTCTCATTCAGAAATCGGTTTTCAGAAACCAACCTCTTGACTCAATAGGTACAAAGAT
ATTTCTAGTTCTGACAACAACATCAGAGTGTCCCTCGAGTTTTGGGGATCGCCAGGGCTGAAAAATATCCTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail