Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051290
Gene name
Locationscaffold_2:3191085..3192321
Strand-
Gene length (bp)1236
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 6.3E-16 98 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 90 411 3.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5662 0.4789 0.6202 0.0721 0.0088 0.1074 0.1565 0.0918 0.1971 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup212
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|204800
Agaricus bisporus var bisporus H39 AgabiH39|205100
Agaricus bisporus var bisporus H39 AgabiH39|347900
Agaricus bisporus var bisporus H39 AgabiH39|364900
Agaricus bisporus var bisporus H39 AgabiH39|391000
Agaricus bisporus var bisporus H39 AgabiH39|391100
Agaricus bisporus var bisporus H39 AgabiH39|418500
Agaricus bisporus var bisporus H39 AgabiH39|418600
Agaricus bisporus var bisporus H39 AgabiH39|438900
Agaricus bisporus var bisporus H39 AgabiH39|514600
Agaricus bisporus var bisporus H39 AgabiH39|514700
Agaricus bisporus var bisporus H97 AgabiH97|089860
Agaricus bisporus var bisporus H97 AgabiH97|051290 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|051280
Agaricus bisporus var bisporus H97 AgabiH97|050950
Agaricus bisporus var bisporus H97 AgabiH97|040830
Agaricus bisporus var bisporus H97 AgabiH97|013320
Agaricus bisporus var bisporus H97 AgabiH97|016480
Agaricus bisporus var bisporus H97 AgabiH97|016290
Agaricus bisporus var bisporus H97 AgabiH97|013330
Agaricus bisporus var bisporus H97 AgabiH97|028980
Rhodonia placenta FPRL280 RhoplFPRL280|795_3
Rhodonia placenta FPRL280 RhoplFPRL280|250_1
Rhodonia placenta FPRL280 RhoplFPRL280|880_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051290
MSSTAVMNDVLPPTVPALDVSGTNWAIFELRFRMVIQGKGLWGHFDGSTPRPTPPRAITPASHPSTPVLATSPST
AAAAVQVPIPSTPTPTVAEIDAWDRNENIALSLLAQRIPDSTLVVVSAQTTVKLMWDKIVRDYTYKSAFSQANLR
QDFMSSCCPSGGDVRLFLNELRAKKAELLAIGVHISDDEYRSAIIQSLPRWLSTYASNQLSAARLHTSLHNTIDP
DMLIVMICDEWDRTRRFAKKGQKSEGNDALAVEEEGKGKKKGKGKGKAKDGERKKGPCWFCQGEHLKKDCAEWKK
KQEEGSSKKDQSKSSANVAEEDDDESFAVDIDKGGKVSETIARVEVFDSGSSRHISPYRDMFTSLQMIQPCALRT
ANQQCLNAIGKGEIKLDLPNGDSRSQLHLKEALYAP*
Coding >AgabiH97|051290
ATGTCAAGTACAGCAGTTATGAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCAATATTTGAATTGCGTTTCCGGATGGTTATTCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGAAATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCATGTTGCCCAAGCGGAGGTGACGTACGCTTGTTCTTGAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGA
TCCTCTCGACACATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACT
GCAAATCAGCAATGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCC
CAACTACATCTTAAAGAAGCACTGTATGCACCTTGA
Transcript >AgabiH97|051290
ATGTCAAGTACAGCAGTTATGAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCAATATTTGAATTGCGTTTCCGGATGGTTATTCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGAAATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCATGTTGCCCAAGCGGAGGTGACGTACGCTTGTTCTTGAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGA
TCCTCTCGACACATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACT
GCAAATCAGCAATGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCC
CAACTACATCTTAAAGAAGCACTGTATGCACCTTGA
Gene >AgabiH97|051290
ATGTCAAGTACAGCAGTTATGAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCAATATTTGAATTGCGTTTCCGGATGGTTATTCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGAAATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCATGTTGCCCAAGCGGAGGTGACGTACGCTTGTTCTTGAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGA
TCCTCTCGACACATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACT
GCAAATCAGCAATGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCC
CAACTACATCTTAAAGAAGCACTGTATGCACCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail